PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01007007001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 188aa MW: 21649.6 Da PI: 7.0289 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 168.5 | 5.5e-52 | 41 | 181 | 232 | 373 |
GRAS 232 kslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaG 323 +sl+Pkvv++veqe+++n++ Fl rf+e+l+yy+a+f+s+++ pr++++ri+ E+++++r+ivn++acegaer+erhe l+kWr+r+ +aG GSVIVT01007007001 41 WSLQPKVVTLVEQESNTNTSAFLPRFVETLDYYTAMFESIDVARPRNDKQRINAEQHCVARDIVNIIACEGAERVERHELLGKWRSRFLMAG 132 89****************************************************************************************** PP GRAS 324 FkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 F+p+pls+++ +k +l++++ + + ++e++g+l+lgWk+r L + +aW GSVIVT01007007001 133 FNPYPLSSSVSLAIKDMLKEYSPN-FWLQERNGALYLGWKNRILATSCAW 181 **********************55.************************* PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 26.085 | 1 | 163 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 1.9E-49 | 41 | 181 | IPR005202 | Transcription factor GRAS |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
MQTSEEHQSS GGIHRLYHQP VQELQPYCLW SQFLESPSKG WSLQPKVVTL VEQESNTNTS 60 AFLPRFVETL DYYTAMFESI DVARPRNDKQ RINAEQHCVA RDIVNIIACE GAERVERHEL 120 LGKWRSRFLM AGFNPYPLSS SVSLAIKDML KEYSPNFWLQ ERNGALYLGW KNRILATSCA 180 WVLRLDP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5b3h_A | 2e-18 | 43 | 184 | 240 | 380 | Protein SCARECROW |
5b3h_D | 2e-18 | 43 | 184 | 240 | 380 | Protein SCARECROW |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.11594 | 0.0 | fruit | ||||
Vvi.2540 | 0.0 | fruit| leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, roots, cotyledons, leaves and flowers. {ECO:0000269|PubMed:18500650}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM439116 | 0.0 | AM439116.2 Vitis vinifera contig VV78X211539.4, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002272401.1 | 1e-97 | PREDICTED: scarecrow-like protein 21 | ||||
Refseq | XP_010647042.1 | 1e-97 | PREDICTED: scarecrow-like protein 21 | ||||
Swissprot | Q9S7H5 | 3e-73 | SCL21_ARATH; Scarecrow-like protein 21 | ||||
TrEMBL | A0A438DDW7 | 3e-96 | A0A438DDW7_VITVI; Scarecrow-like protein 13 | ||||
TrEMBL | A0A438HRU2 | 3e-96 | A0A438HRU2_VITVI; Scarecrow-like protein 13 | ||||
TrEMBL | F6HRV6 | 3e-96 | F6HRV6_VITVI; Uncharacterized protein | ||||
STRING | VIT_00s0463g00020.t01 | 5e-97 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP14896 | 4 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G04890.1 | 1e-75 | SCARECROW-like 21 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01007007001 |
Publications ? help Back to Top | |||
---|---|---|---|
|