PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01002442001
Organism
Vitis vinifera
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family M-type_MADS
Protein Properties Length: 110aa    MW: 12618 Da    PI: 10.6963
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01002442001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.62.9e-273383151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       k+i n+  rqvtfskRr g++KKA+ELS+LCdae+a+i+fs  gkl+eyss
  GSVIVT01002442001 33 KKIGNTAARQVTFSKRRRGLFKKAQELSTLCDAEIALIVFSAAGKLFEYSS 83
                       6899*********************************************96 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.57E-262587IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-352584IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.952585IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-262747IPR002100Transcription factor, MADS-box
CDDcd002652.52E-3428105No hitNo description
PfamPF003196.5E-253481IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-264762IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-266283IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MCFSLFMYGL VLIFSVKGWV ENFPMAQQKI QIKKIGNTAA RQVTFSKRRR GLFKKAQELS  60
TLCDAEIALI VFSAAGKLFE YSSSRLVFSS LPFLLFIHRY MNLSAFCRQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A5e-182586162MEF2 CHIMERA
6byy_B5e-182586162MEF2 CHIMERA
6byy_C5e-182586162MEF2 CHIMERA
6byy_D5e-182586162MEF2 CHIMERA
6bz1_A5e-182586162MEF2 CHIMERA
6bz1_B5e-182586162MEF2 CHIMERA
6bz1_C5e-182586162MEF2 CHIMERA
6bz1_D5e-182586162MEF2 CHIMERA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.147077e-97stem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During vegetative phase, expressed in the entire shoot apical meristem and in emerging leaf primordia. During floral transition, gradually detectable in the transitional shoot apex and young cauline leaves. Detected in the inflorescence meristem. Present throughout the tunica (superficial layers) of the floral meristem during early stages of flower development. Later disappears prior to emergence of sepal primordia. At later stages of floral development, weakly expressed in the distal parts of stamens and carpels. Then restricted to pollen and the adaxial surface of the gynoecium. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:19656343}.
UniprotTISSUE SPECIFICITY: Mostly expressed in shoot apical meristems, including floral meristems. Also detected in stems, seedlings, leaves, flowers and siliques, and, to a lower extent, in roots. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:19656343}.
UniprotTISSUE SPECIFICITY: Widely expressed with highest levels in shoot tips and axillary buds. Also found in fully developed pedicels and flowers.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state.
UniProtTranscription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18466303, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18694458}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4582321e-168AM458232.1 Vitis vinifera contig VV79X006609.2, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002262889.22e-36PREDICTED: MADS-box protein SVP isoform X2
RefseqXP_010661294.24e-36PREDICTED: MADS-box protein AGL24 isoform X1
RefseqXP_010661297.22e-36PREDICTED: MADS-box protein SVP isoform X3
SwissprotO827943e-27AGL24_ARATH; MADS-box protein AGL24
SwissprotQ9FUY65e-27JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLD7UBC11e-53D7UBC1_VITVI; Uncharacterized protein
STRINGVIT_15s0024g02000.t012e-54(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24540.11e-29AGAMOUS-like 24
Publications ? help Back to Top
  1. Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP
    Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae).
    PLoS ONE, 2013. 8(6): p. e67243
    [PMID:23840638]
  2. Lei HJ, et al.
    Identification and characterization of FaSOC1, a homolog of SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1 from strawberry.
    Gene, 2013. 531(2): p. 158-67
    [PMID:24055423]
  3. Nakano T,Kato H,Shima Y,Ito Y
    Apple SVP Family MADS-Box Proteins and the Tomato Pedicel Abscission Zone Regulator JOINTLESS have Similar Molecular Activities.
    Plant Cell Physiol., 2015. 56(6): p. 1097-106
    [PMID:25746985]
  4. Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG
    A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch].
    BMC Plant Biol., 2015. 15: p. 41
    [PMID:25848674]
  5. Sacharowski SP, et al.
    SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development.
    Plant Cell, 2015. 27(7): p. 1889-906
    [PMID:26106148]
  6. Sun LM,Zhang JZ,Hu CG
    Characterization and Expression Analysis of PtAGL24, a SHORT VEGETATIVE PHASE/AGAMOUS-LIKE 24 (SVP/AGL24)-Type MADS-Box Gene from Trifoliate Orange (Poncirus trifoliata L. Raf.).
    Front Plant Sci, 2016. 7: p. 823
    [PMID:27375669]