PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01000175001 | ||||||||
Common Name | VITISV_040997 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 63aa MW: 6991.33 Da PI: 11.2723 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 79.1 | 3.1e-25 | 9 | 53 | 1 | 45 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 k+ienk rqvtf+kRrng+lKKA+E+S+LCd+eva++ fs++gk GSVIVT01000175001 9 KKIENKAVRQVTFAKRRNGLLKKAYEISTLCDIEVALLAFSPSGK 53 78*****************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.7E-32 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 26.338 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.29E-25 | 2 | 59 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-23 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.0E-24 | 10 | 55 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-23 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-23 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 63 aa Download sequence Send to blast |
MGRQRVEIKK IENKAVRQVT FAKRRNGLLK KAYEISTLCD IEVALLAFSP SGKPTIFGGK 60 KR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-15 | 1 | 53 | 1 | 53 | MEF2 CHIMERA |
6byy_B | 2e-15 | 1 | 53 | 1 | 53 | MEF2 CHIMERA |
6byy_C | 2e-15 | 1 | 53 | 1 | 53 | MEF2 CHIMERA |
6byy_D | 2e-15 | 1 | 53 | 1 | 53 | MEF2 CHIMERA |
6bz1_A | 2e-15 | 1 | 53 | 1 | 53 | MEF2 CHIMERA |
6bz1_B | 2e-15 | 1 | 53 | 1 | 53 | MEF2 CHIMERA |
6bz1_C | 2e-15 | 1 | 53 | 1 | 53 | MEF2 CHIMERA |
6bz1_D | 2e-15 | 1 | 53 | 1 | 53 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM462251 | 1e-101 | AM462251.2 Vitis vinifera contig VV78X147749.46, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010652754.1 | 2e-34 | PREDICTED: MADS-box transcription factor 8 isoform X1 | ||||
Refseq | XP_019076584.1 | 2e-34 | PREDICTED: agamous-like MADS-box protein AGL66 isoform X2 | ||||
Swissprot | Q1PFC2 | 2e-23 | AGL66_ARATH; Agamous-like MADS-box protein AGL66 | ||||
TrEMBL | A0A438FBZ0 | 7e-34 | A0A438FBZ0_VITVI; Agamous-like MADS-box protein AGL66 | ||||
TrEMBL | D7TTB7 | 9e-37 | D7TTB7_VITVI; Uncharacterized protein | ||||
STRING | VIT_07s0129g00650.t01 | 1e-37 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G77980.1 | 9e-26 | AGAMOUS-like 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01000175001 |
Publications ? help Back to Top | |||
---|---|---|---|
|