PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TF ID | Vun006628 | ||||||||||||
Organism | |||||||||||||
Taxonomic ID | |||||||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||||||
Family | NF-YB | ||||||||||||
Protein Properties | Length: 123aa MW: 13984.7 Da PI: 6.5128 | ||||||||||||
Description | NF-YB family protein | ||||||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 175 | 7.6e-55 | 11 | 107 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 ++eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++walatl f+dy++plk yl+kyrelege+ Vun006628 11 MKEQDRLLPIANVGRIMKQTLPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALATLRFDDYADPLKRYLHKYRELEGER 107 58*********************************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.3E-52 | 9 | 114 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.81E-40 | 14 | 113 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.2E-28 | 17 | 81 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.5E-19 | 45 | 63 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 48 | 64 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.5E-19 | 64 | 82 | No hit | No description |
PRINTS | PR00615 | 4.5E-19 | 83 | 101 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 123 aa Download sequence Send to blast |
GSDSCAQDGV MKEQDRLLPI ANVGRIMKQT LPPNAKISKE AKETMQECVS EFISFVTGEA 60 SDKCHKEKRK TVNGDDICWA LATLRFDDYA DPLKRYLHKY RELEGERANQ NKSNTYENNI 120 ANI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-44 | 11 | 102 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-44 | 11 | 102 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027935662.1 | 3e-87 | nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 3e-59 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A4D6MYM0 | 6e-86 | A0A4D6MYM0_VIGUN; Nuclear transcription factor Y | ||||
STRING | XP_007144547.1 | 3e-79 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-61 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|