PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TF ID | Vun006552 | ||||||||||||
Organism | |||||||||||||
Taxonomic ID | |||||||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||||||
Family | NF-YB | ||||||||||||
Protein Properties | Length: 129aa MW: 14400.4 Da PI: 6.2666 | ||||||||||||
Description | NF-YB family protein | ||||||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 182.4 | 3.8e-57 | 19 | 114 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 reqdr+lPianv+rimkkvlP+nakisk++ket+qecvsefisfvt+easdkcq+ekrktingddllwa+a+lGfedy+eplk+yl+kyre+egek Vun006552 19 REQDRLLPIANVGRIMKKVLPGNAKISKESKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMASLGFEDYAEPLKAYLHKYREMEGEK 114 89********************************************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.8E-53 | 14 | 117 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.33E-41 | 21 | 124 | IPR009072 | Histone-fold |
Pfam | PF00808 | 9.4E-28 | 24 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 9.0E-22 | 52 | 70 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 55 | 71 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 9.0E-22 | 71 | 89 | No hit | No description |
PRINTS | PR00615 | 9.0E-22 | 90 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 129 aa Download sequence Send to blast |
MAESDNESGG GKNESSICRE QDRLLPIANV GRIMKKVLPG NAKISKESKE TMQECVSEFI 60 SFVTGEASDK CQKEKRKTIN GDDLLWAMAS LGFEDYAEPL KAYLHKYREM EGEKTAMIGK 120 HHGLYANPL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-47 | 19 | 109 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-47 | 19 | 109 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027917771.1 | 1e-92 | nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 4e-64 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A4D6KZS7 | 2e-91 | A0A4D6KZS7_VIGUN; Nuclear transcription factor Y | ||||
STRING | XP_007154047.1 | 1e-88 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 2e-66 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|