PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vradi07g14790.1

Organism

Vigna radiata

Taxonomic ID

157791

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

MYB

Protein Properties

Length: 190aa MW: 21854.7 Da PI: 9.1823

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vradi07g14790.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	52.6	1e-16	10	57	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W +eEd l ++vk++G+g W++I++ g++R++k+c++rw +yl Vradi07g14790.1 10 KGFWNAEEDSVLTNYVKKHGTGKWNRIPKVTGLKRSGKSCRLRWMNYL 57 688*******************************************97 PP
2	Myb_DNA-binding	55.8	1.1e-17	63	108	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg +++eE++l v+++ +lG++ W++Ia +++ gRt++q+k++w+++l Vradi07g14790.1 63 RGEFSEEEEDLVVRLHSLLGNR-WSLIAGRIP-GRTDNQVKNFWNTHL 108 899*****************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	15.691	5	57	IPR017930	Myb domain
SuperFamily	SSF46689	6.97E-30	8	104	IPR009057	Homeodomain-like
SMART	SM00717	2.1E-13	9	59	IPR001005	SANT/Myb domain
Pfam	PF00249	3.7E-14	11	57	IPR001005	SANT/Myb domain
CDD	cd00167	9.34E-11	13	57	No hit	No description
Gene3D	G3DSA:1.10.10.60	6.0E-22	13	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	26.459	58	112	IPR017930	Myb domain
SMART	SM00717	1.5E-16	62	110	IPR001005	SANT/Myb domain
Pfam	PF00249	2.3E-16	63	108	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.2E-25	65	112	IPR009057	Homeodomain-like
CDD	cd00167	9.91E-12	65	108	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048765	Biological Process	root hair cell differentiation
GO:0090377	Biological Process	seed trichome initiation
GO:0090378	Biological Process	seed trichome elongation
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 190 aa Download sequence Send to blast
MEAYENESKK GFWNAEEDSV LTNYVKKHGT GKWNRIPKVT GLKRSGKSCR LRWMNYLTPD 60 VKRGEFSEEE EDLVVRLHSL LGNRWSLIAG RIPGRTDNQV KNFWNTHLSK KLGVVDKKKK 120 KRKASSKERS GEGDGEKLWS DDLMELGNMH EEIIRDDFGC SFSFPNISVF DLCTSPYCTQ 180 SFHHSFFAL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	5e-27	10	112	7	108	B-MYB
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	116	122	KKKKKRK
2	117	122	KKKKRK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269\|PubMed:10589676, ECO:0000269\|PubMed:11585796, ECO:0000269\|PubMed:14627722, ECO:0000269\|PubMed:15361138, ECO:0000269\|PubMed:15795220, ECO:0000269\|PubMed:16207757}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vradi07g14790.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:16176989}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015034	8e-61	AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022638520.1	1e-139	transcription factor WER-like
Swissprot	Q9SEI0	8e-61	WER_ARATH; Transcription factor WER
TrEMBL	A0A3Q0F3B7	1e-138	A0A3Q0F3B7_VIGRR; transcription factor WER-like
STRING	XP_007155422.1	1e-105	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G14750.1	2e-56	myb domain protein 66

Publications ? help Back to Top
Savage N, et al. Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] Cheng Y, et al. Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases. Elife, 2018. [PMID:24771765] Kiefer CS, et al. Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity. Development, 2015. 142(5): p. 1022 [PMID:25715402] Kwak SH,Song SK,Lee MM,Schiefelbein J TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(12): p. e1103407 [PMID:26451798] Zhu Y, et al. The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development. Plant Cell, 2017. 29(2): p. 260-276 [PMID:28138017] Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana. Plant J., 2017. 92(2): p. 305-316 [PMID:28771873] Mira MM, et al. Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit. J. Exp. Bot., 2017. 68(20): p. 5653-5668 [PMID:29059380] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308]