PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi07g05010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 84aa MW: 9568.28 Da PI: 6.5047 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 39.2 | 1.3e-12 | 2 | 52 | 43 | 94 |
S-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS B3 43 grsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 g+sW++ ++ ++k +++ +GWk+F+ +n L++gD ++F+l+++s+++ + Vradi07g05010.1 2 GKSWDMVYCGQNKL-QVFRPAGWKKFAVENCLRVGDACIFELMESSDKKVIF 52 89******544444.566779*********************9887776554 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 12.407 | 1 | 60 | IPR003340 | B3 DNA binding domain |
CDD | cd10017 | 3.70E-10 | 2 | 58 | No hit | No description |
Gene3D | G3DSA:2.40.330.10 | 1.7E-11 | 2 | 58 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 2.9E-10 | 2 | 53 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 1.18E-11 | 2 | 51 | IPR015300 | DNA-binding pseudobarrel domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 84 aa Download sequence Send to blast |
MGKSWDMVYC GQNKLQVFRP AGWKKFAVEN CLRVGDACIF ELMESSDKKV IFEVQILRGD 60 IPSEILKNEM IMGQNREMPI VLN* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi07g05010.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 1e-122 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014508354.1 | 1e-55 | B3 domain-containing protein Os06g0112300 | ||||
TrEMBL | A0A1S3UR05 | 3e-54 | A0A1S3UR05_VIGRR; B3 domain-containing protein Os06g0112300 | ||||
STRING | XP_007157818.1 | 2e-48 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF9722 | 26 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G33280.1 | 2e-07 | B3 family protein |