PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi05g21580.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 156aa MW: 18058.3 Da PI: 10.3967 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 53.4 | 5.4e-17 | 85 | 128 | 5 | 49 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 kr++r++kNRe+A rsR+RK+a++ eLe kv Le+eN++L+ Vradi05g21580.1 85 KRQKRMIKNRESAARSRARKQAYTTELEHKVSRLEEENQKLRR-Q 128 9****************************************93.3 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.1E-11 | 81 | 153 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.438 | 83 | 128 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 5.3E-15 | 85 | 128 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 5.13E-12 | 85 | 130 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 2.0E-15 | 85 | 129 | No hit | No description |
CDD | cd14707 | 5.55E-19 | 85 | 130 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 88 | 103 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MESKDGDDKN EKHLQQHPLV KGGVVVEASS TLVNPQQAQY QIPQGLMEIY MTGQNIAQSL 60 HTQDNVTSDE HGRKRGTSQD KAFEKRQKRM IKNRESAARS RARKQAYTTE LEHKVSRLEE 120 ENQKLRRQKE IEDISSIMPP QKPRYQIRRT KSAWF* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi05g21580.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015040 | 5e-31 | AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014499537.1 | 1e-112 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
Swissprot | Q9LES3 | 8e-29 | AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
TrEMBL | A0A1S3U0J7 | 1e-111 | A0A1S3U0J7_VIGRR; ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
STRING | XP_007148757.1 | 2e-57 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3755 | 32 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G56850.1 | 3e-31 | ABA-responsive element binding protein 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|