PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi02g11280.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 216aa MW: 24139.3 Da PI: 9.8069 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 103.2 | 3.4e-32 | 9 | 84 | 52 | 128 |
NAM 52 kaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 + +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+++s ++++vg+kk+Lvfy g+ pkg+ktdW+mheyrl Vradi02g11280.1 9 SFGEEEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPICS-GTQKVGVKKSLVFYGGKPPKGVKTDWIMHEYRL 84 44789**************************************.999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 40.86 | 1 | 118 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.57E-39 | 8 | 118 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.2E-15 | 13 | 84 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 216 aa Download sequence Send to blast |
MLISTTKASF GEEEWYFFSP RDRKYPNGAR PNRAATSGYW KATGTDKPIC SGTQKVGVKK 60 SLVFYGGKPP KGVKTDWIMH EYRLVETKPN NRPPGCDLGH KKNSLRLDDW VLCRIYKKGN 120 TQRSGMEQER DDSMDEMIGE VPSSMNVGHM NARFHLSKIN GNVSVMRTEE NNASPGSFAT 180 LLNQLPQTPS LPQIGSMGDG LLRTQYQLQG TNWYG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-48 | 7 | 121 | 65 | 168 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-48 | 7 | 121 | 65 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-48 | 7 | 121 | 65 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-48 | 7 | 121 | 65 | 168 | NO APICAL MERISTEM PROTEIN |
4dul_A | 5e-48 | 7 | 121 | 65 | 168 | NAC domain-containing protein 19 |
4dul_B | 5e-48 | 7 | 121 | 65 | 168 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi02g11280.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015039 | 1e-151 | AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014518387.1 | 1e-111 | NAC transcription factor 56 isoform X3 | ||||
Refseq | XP_022634499.1 | 1e-111 | NAC transcription factor 56 isoform X1 | ||||
Swissprot | Q9LD44 | 1e-75 | NAC56_ARATH; NAC transcription factor 56 | ||||
TrEMBL | A0A1S3VJJ7 | 1e-110 | A0A1S3VJJ7_VIGRR; NAC transcription factor 56 isoform X3 | ||||
TrEMBL | A0A3Q0EVP9 | 1e-110 | A0A3Q0EVP9_VIGRR; NAC transcription factor 56 isoform X1 | ||||
STRING | XP_007133059.1 | 1e-106 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1623 | 34 | 98 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15510.1 | 5e-78 | NAC domain containing protein 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|