PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi0235s00070.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 139aa MW: 15402.8 Da PI: 10.7494 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 67.1 | 4.9e-21 | 81 | 138 | 62 | 120 |
NAM 62 skrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektd 120 ++d+ky++g+r nrat++gyWkatgkd++++s +++l+g+kktLvfy+grapkg++t+ Vradi0235s00070.1 81 KTKDRKYPNGHRLNRATNHGYWKATGKDRKIKS-GSALIGMKKTLVFYTGRAPKGKRTN 138 5689*****************************.9**********************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 17.544 | 17 | 138 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 3.92E-21 | 81 | 138 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.6E-6 | 90 | 129 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 139 aa Download sequence Send to blast |
MARGFGAKKM KVMRNGGGVA ACLRGEDDEN ARLVRCENLF EDGNHLYRVL DDDLIVVSQC 60 HNISRGISTL KPKPLAENCV KTKDRKYPNG HRLNRATNHG YWKATGKDRK IKSGSALIGM 120 KKTLVFYTGR APKGKRTN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-16 | 83 | 138 | 79 | 134 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-16 | 83 | 138 | 79 | 134 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-16 | 83 | 138 | 79 | 134 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-16 | 83 | 138 | 79 | 134 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-16 | 83 | 138 | 82 | 137 | NAC domain-containing protein 19 |
3swm_B | 2e-16 | 83 | 138 | 82 | 137 | NAC domain-containing protein 19 |
3swm_C | 2e-16 | 83 | 138 | 82 | 137 | NAC domain-containing protein 19 |
3swm_D | 2e-16 | 83 | 138 | 82 | 137 | NAC domain-containing protein 19 |
3swp_A | 2e-16 | 83 | 138 | 82 | 137 | NAC domain-containing protein 19 |
3swp_B | 2e-16 | 83 | 138 | 82 | 137 | NAC domain-containing protein 19 |
3swp_C | 2e-16 | 83 | 138 | 82 | 137 | NAC domain-containing protein 19 |
3swp_D | 2e-16 | 83 | 138 | 82 | 137 | NAC domain-containing protein 19 |
4dul_A | 2e-16 | 83 | 138 | 79 | 134 | NAC domain-containing protein 19 |
4dul_B | 2e-16 | 83 | 138 | 79 | 134 | NAC domain-containing protein 19 |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi0235s00070.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015036 | 2e-76 | AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari. |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G35580.3 | 1e-27 | NAC transcription factor-like 9 |