PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi01g09670.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 166aa MW: 18844.7 Da PI: 10.3196 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 174.5 | 3e-54 | 9 | 139 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGfrFhPtdeel+ +yL+kkv++ +l++ ++i+evdiyk++Pw+Lp+k++ +ekewyfFs+rd+ky++g r+nra++sgyWkatg+dk++++ Vradi01g09670.1 9 LPPGFRFHPTDEELILHYLRKKVASIPLPV-SIIAEVDIYKCDPWELPAKAAFGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKNIVA 101 79****************************.89***************988899**************************************** PP NAM 95 k....kgelvglkktLvfykgrapkgektdWvmheyrl 128 + +e+ g+kk Lvfykg+ pkg+kt+W+mheyrl Vradi01g09670.1 102 SlgggVREHFGVKKALVFYKGKPPKGVKTNWIMHEYRL 139 998776677***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.83E-60 | 5 | 144 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.786 | 9 | 162 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.4E-28 | 10 | 139 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MGTPQSNNLP PGFRFHPTDE ELILHYLRKK VASIPLPVSI IAEVDIYKCD PWELPAKAAF 60 GEKEWYFFSP RDRKYPNGAR PNRAAASGYW KATGTDKNIV ASLGGGVREH FGVKKALVFY 120 KGKPPKGVKT NWIMHEYRLV DTNKPVRIKD TSMRVSFPIY FHHNN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 2e-63 | 8 | 144 | 19 | 150 | NAC domain-containing protein 19 |
3swm_B | 2e-63 | 8 | 144 | 19 | 150 | NAC domain-containing protein 19 |
3swm_C | 2e-63 | 8 | 144 | 19 | 150 | NAC domain-containing protein 19 |
3swm_D | 2e-63 | 8 | 144 | 19 | 150 | NAC domain-containing protein 19 |
3swp_A | 2e-63 | 8 | 144 | 19 | 150 | NAC domain-containing protein 19 |
3swp_B | 2e-63 | 8 | 144 | 19 | 150 | NAC domain-containing protein 19 |
3swp_C | 2e-63 | 8 | 144 | 19 | 150 | NAC domain-containing protein 19 |
3swp_D | 2e-63 | 8 | 144 | 19 | 150 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi01g09670.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015044 | 1e-166 | AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014517325.1 | 1e-112 | NAC transcription factor 47 | ||||
Swissprot | Q84TD6 | 6e-82 | NAC47_ARATH; NAC transcription factor 47 | ||||
TrEMBL | A0A1S3VGC1 | 1e-111 | A0A1S3VGC1_VIGRR; NAC transcription factor 47 | ||||
STRING | XP_007151816.1 | 1e-109 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6621 | 27 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G04070.2 | 1e-84 | NAC domain containing protein 47 |
Publications ? help Back to Top | |||
---|---|---|---|
|