PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vocar.0019s0157.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Volvox
Family Nin-like
Protein Properties Length: 969aa    MW: 102923 Da    PI: 6.7947
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vocar.0019s0157.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK63.73.1e-20845895252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          e ++++e l+++F+lp++d++++Lgv+ T LKr+CR +GI RWP+Rk++sl
  Vocar.0019s0157.1.p 845 EVQVTMELLRSMFHLPVADVSRTLGVSSTDLKRRCRALGIGRWPQRKLTSL 895
                          56899*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.587828915IPR003035RWP-RK domain
PfamPF020425.4E-18847895IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 969 aa     Download sequence    Send to blast
MMELFDEDDE EFFRRSRQIC EGKRFADDVR HGLSSSGPTS RQFTFPQGYF NQNGDVLEAI  60
GAWPISAPSS LDQGMLAIDA RHNEDCALRP SSPKMASSHL ACLNLGSSLP ANPGPELSAL  120
PGAWLPQSQP QSAAQMSQLP ASWAAAPASA PSAAYIPAPA PSAVYVPAPA PAPSAAYMPA  180
PAPAPSAAYM PAPAPAPSAA YMPAPGPGPA QVPNPSPPAS MHASTSTVYA PPVPQLTAPA  240
RGGRWALGYP HKPSFGPHGG QQQQMVVAAG GAPPPPPLGA TPALVGADLP ASRSVVIGTV  300
FQETYEQCQR QPQQLLLHHQ HQGLQAQLPQ QCTVAQPHQQ QHHQQPRIQQ PMQPMQQMQQ  360
PVQLRMQQQM QSMQEQQQMQ QQQQQQQLEQ RKLELQRHSQ LQQHWQQQQQ QTQLQPAHST  420
TWYLEAKPQL LQPLVCAHPR GDLPSRYPRL QPLEAQPAQV GQLPSQPKLQ LQPDPLPLLP  480
LPPPPPPPLP PQLLSSSHYD DVQEEDYLMA EILAAPWPSS KTVQDATAAA HAAAAALART  540
KLVTHNERAN PQPKPSGAPQ QVSMEAAAAS AFAAPECGPN TPSQSPPPLP ESWQGSRRVQ  600
AAPDDAPLKK LNEAVVEAAP APARPRWISV HDQGAVPWKI KAELGGAEVK AEMRPLGQSA  660
MALGSDHPRA NLTLKQQTTL LYEHQLQLVV PQGDLRLGQL DMAASRKLAA GAAAAAAAAA  720
ASAGPVATDG ADRGGTLLLH VPLAGGRTSS TVVVDDMHDD SMQDDLPPPP SLPLDVFMAD  780
DLAECDGEDS DCDSDVTMTA AGGPTTATTS TAAAAPAAAT AAAATAVAAA TTADPSPIGG  840
SKAAEVQVTM ELLRSMFHLP VADVSRTLGV SSTDLKRRCR ALGIGRWPQR KLTSLDKLGG  900
AVASDPHISE DERQKTLALV ARNRDDIIRD PDTALDPWVA PKRQMHYKRK FVDRRGGGRR  960
SYGKKKGG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002950054.10.0RWP-RK domain-containing transcription factor
TrEMBLD8TUK10.0D8TUK1_VOLCA; RWP-RK domain-containing transcription factor
STRINGXP_002950054.10.0(Volvox carteri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP841650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.15e-11RWP-RK domain-containing protein