PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vocar.0015s0365.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Volvox
Family Nin-like
Protein Properties Length: 1004aa    MW: 103274 Da    PI: 7.126
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vocar.0015s0365.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK77.31.7e-24538587352
               RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          k++++edl+++F l +k+AA++Lg+c+T+LKr+CR++GIkRWP+R+i++l
  Vocar.0015s0365.2.p 538 KRLRFEDLQAQFGLGLKEAANNLGICATTLKRACRRNGIKRWPRRQIAKL 587
                          899********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.892522607IPR003035RWP-RK domain
PfamPF020421.1E-19540587IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 1004 aa     Download sequence    Send to blast
MAHSSLGLLA GGSDLKQRLS KALLDVSGTL ASVKSGALVQ VWMPEHTHDG TIVLSCQGLP  60
FAVAGVGDLL ALFRCVSVRY RFSTDVMKPT LMGAIGRVYS TLEPEMSHNV QKYDKQVYLR  120
VSEAQRCRVH STLMVPVFGS DSRDTPLAVF ELVQGDKDVT FPAVLSHLTA SLQNVHLFTT  180
DLETAAIAAG LRKWPMHIDM MPSAEHDSAG VGRLSPSRDE PRLMSNFQNM QAGAEEKEQA  240
ASSNVVSTEE KQSPNASKGD EAGSRACEWT SQSGAARLSV GNPIGQTCPA GQAPSSGLMA  300
TSGSGASRLM AGPAPAAPAT MGPTLGICSN SGAAVGKPEA VAAQGFEVST ADGVGARRQS  360
GTGPMEASNA QQFMSWLAQQ NATGNNALGQ LRTLLEQQQQ RSKAEQSGGN LLGQQTASGT  420
QPQSMDALAA SMGASLGMVP PNMAASPTKG SVMQQHAAFD MAAATAATTA AATTTTTSDK  480
QGNKLTRSGS VQRTLGAAAD ADDGDGEDIS SGGEDDDSDD ERPGGHRNNN RVGGGAGKRL  540
RFEDLQAQFG LGLKEAANNL GICATTLKRA CRRNGIKRWP RRQIAKLSKA LNQMGYNGAP  600
PPGLVQNAVV SAGASSGQAA VKPKPAKKPD AAALQQATQL LFQHQLGAAA AAAAAAGGGG  660
MFTNLSTAGM VVGGQLQGIP QGLHGMYGVA GQPAQQQHQP PPQQAGMFSG PFMGPMGAIM  720
AQHGGNVPSG VLGQGPQALL GAMGGIGGGL GAAIQMPVMG SLGGLQGSAM GPMQTAALGL  780
QLQGAGGLQL QGAGSTGMPV HGHTGMLHPL LAGGSFNMHQ ALQQQQQFQQ QLQAAHHQQQ  840
QQQQTSSLLQ QQHAVLQQQM QIQQQVQQQQ QQQQQQQQQL GPVALQQMGK PDAVSWLVQA  900
QAQAAPQASL AANGMTTASS AMDISAPRIS CGEAHSPFSA LGMSPAMSGG NTELCGLAEI  960
PEDFIQNLNS GGVSQFGQLL KSGTLGVGTM ELMDLLGDDI AAR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002946865.10.0RWP-RK domain-containing transcription factor
TrEMBLD8TKM70.0D8TKM7_VOLCA; RWP-RK domain-containing transcription factor
STRINGXP_002946865.10.0(Volvox carteri)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38340.15e-14Nin-like family protein