PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vocar.0015s0365.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Volvox
Family Nin-like
Protein Properties Length: 1005aa    MW: 103345 Da    PI: 7.126
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vocar.0015s0365.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK77.31.7e-24539588352
               RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          k++++edl+++F l +k+AA++Lg+c+T+LKr+CR++GIkRWP+R+i++l
  Vocar.0015s0365.1.p 539 KRLRFEDLQAQFGLGLKEAANNLGICATTLKRACRRNGIKRWPRRQIAKL 588
                          899********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.892523608IPR003035RWP-RK domain
PfamPF020421.1E-19541588IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 1005 aa     Download sequence    Send to blast
MAHSSLGLLA GGSDLKQRLS KALLDVSGTL ASVKSGALVQ VWMPEHTHDG TIVLSCQGLP  60
FAVAGVGDLL ALFRCVSVRY RFSTDVMKPT LMGAIGRVYS TLEPEMSHNV QKYDKQVYLR  120
VSEAQRCRVH STLMVPVFGS DSRDTPLAVF ELVQGDKDVT FPAVLSHLTA SLQNVHLFTT  180
DLETAAIAAG LRKWPMHIDM MPSAEHDSAG VGRLSPSRDE PRLMSNFQNM QAGAEEKEQA  240
ASSNVVSTAE EKQSPNASKG DEAGSRACEW TSQSGAARLS VGNPIGQTCP AGQAPSSGLM  300
ATSGSGASRL MAGPAPAAPA TMGPTLGICS NSGAAVGKPE AVAAQGFEVS TADGVGARRQ  360
SGTGPMEASN AQQFMSWLAQ QNATGNNALG QLRTLLEQQQ QRSKAEQSGG NLLGQQTASG  420
TQPQSMDALA ASMGASLGMV PPNMAASPTK GSVMQQHAAF DMAAATAATT AAATTTTTSD  480
KQGNKLTRSG SVQRTLGAAA DADDGDGEDI SSGGEDDDSD DERPGGHRNN NRVGGGAGKR  540
LRFEDLQAQF GLGLKEAANN LGICATTLKR ACRRNGIKRW PRRQIAKLSK ALNQMGYNGA  600
PPPGLVQNAV VSAGASSGQA AVKPKPAKKP DAAALQQATQ LLFQHQLGAA AAAAAAAGGG  660
GMFTNLSTAG MVVGGQLQGI PQGLHGMYGV AGQPAQQQHQ PPPQQAGMFS GPFMGPMGAI  720
MAQHGGNVPS GVLGQGPQAL LGAMGGIGGG LGAAIQMPVM GSLGGLQGSA MGPMQTAALG  780
LQLQGAGGLQ LQGAGSTGMP VHGHTGMLHP LLAGGSFNMH QALQQQQQFQ QQLQAAHHQQ  840
QQQQQTSSLL QQQHAVLQQQ MQIQQQVQQQ QQQQQQQQQQ LGPVALQQMG KPDAVSWLVQ  900
AQAQAAPQAS LAANGMTTAS SAMDISAPRI SCGEAHSPFS ALGMSPAMSG GNTELCGLAE  960
IPEDFIQNLN SGGVSQFGQL LKSGTLGVGT MELMDLLGDD IAAR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002946865.10.0RWP-RK domain-containing transcription factor
TrEMBLD8TKM70.0D8TKM7_VOLCA; RWP-RK domain-containing transcription factor
STRINGXP_002946865.10.0(Volvox carteri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP376056
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38340.15e-14Nin-like family protein