PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vocar.0015s0235.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Volvox
Family Nin-like
Protein Properties Length: 971aa    MW: 98155.1 Da    PI: 6.7565
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vocar.0015s0235.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK70.52.3e-22664713352
               RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ++i+ e l++ ++l+i++AA+eLg+++T LK  CR +GI+RWP+Rk+ks+
  Vocar.0015s0235.1.p 664 ASITKERLQQVYHLNIEEAARELGIGMTKLKEHCRTLGIPRWPSRKLKSM 713
                          789*********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.154649733IPR003035RWP-RK domain
PfamPF020427.4E-21665712IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 971 aa     Download sequence    Send to blast
MESNGSTAFH AAEFQANVAL VGVATSASLA VQPSTLADMQ ASISAGDSFA FAAASLNPAA  60
MHMNNTVSDM TCAIASDEPP ACGELLRPLA AAEKLPVSDK PLWRPHSELL PPARLVEVAH  120
AALQSSGFRR KLATGAQQPS QHENPNTQPA PASSAAAEAN HTSAAKRELP SDNGCDSDRP  180
YDMKRPRNES CGETAPLLDK VERDAMEGSM DAAGGPVNVT SLLAMPPLVP TVKREVPAPT  240
ILPNASSMTP FSVPLPGQLS GSIDGIMPPL ADTASAAVNG PLKSAFSQAA SLPTEWQPGC  300
SVTTGRRSAR SPAPKGSRKL SLVRATSAEA NSGPLSRRCS GLGAAVLGHG PAEHAAAGTP  360
GGSTAAAPSC AFGPEPGVEN GGTESKSAGQ RGSANGGATA LLESAASADL RRLAQLAEAA  420
AMLEEQMVMK GCDRGAGGGG SGQDVGPGAR SGAPDESGNR AVGPAVRLGA DGSEQAVLRQ  480
RAASFNAGAL LPGSGSALAG ELRTATSVPA SFSAVLRSVG SLPGPVPDGH PASTSGACRI  540
GGGIGGSGRE GSPGAGDDDV LVGSRRRSLM DSEAASEGGS QGGHEMEDDE DEGDGIMGGG  600
DGSNDSAGGG SSAGGGSGRT LTERYRAALK ASAKQRGRGH TIMKLDPDKP PRGSNRNGLC  660
ARIASITKER LQQVYHLNIE EAARELGIGM TKLKEHCRTL GIPRWPSRKL KSMDKLIESL  720
NERAMTEPAT KEVIADILAE IESFKRAIYE NPCLEVEEDI KRLRQSNFKK EYQQRQVEQR  780
LRGGITEKGS VGTLGGGPGG SGRSTSVSSG AHLQSAGPSG AISSAALAPT ASGGTGAALP  840
PAVLSQPMLP AAALAANLGP ALGQLAAGAA AAQSSAQLVQ ALAQAQVQAH VQAQQLPGQV  900
SLLAHGQLQQ LLMAQPSGTL QQLMAQRALG GMPPPALLLP AMLSQHMQQP QLPKPVGPMA  960
AVGEAAPNAE *
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002946737.10.0RWP-RK domain-containing transcription factor
TrEMBLD8TJX20.0D8TJX2_VOLCA; RWP-RK domain-containing transcription factor
STRINGXP_002946737.10.0(Volvox carteri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP841650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.12e-21RWP-RK domain-containing protein