PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vocar.0014s0106.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Volvox
Family Nin-like
Protein Properties Length: 1885aa    MW: 192747 Da    PI: 6.9221
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vocar.0014s0106.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK62.19.8e-2017091757351
               RWP-RK    3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51  
                            ei+ + l+k ++lpi++AA  L++++TvLK+ CR++ ++RWP+Rk++s
  Vocar.0014s0106.1.p 1709 REITKSALRKVYHLPINEAAAALNIGVTVLKKYCRKFRVPRWPYRKLQS 1757
                           689********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.49516941778IPR003035RWP-RK domain
PfamPF020423.3E-1917111757IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 1885 aa     Download sequence    Send to blast
MNTGKGLKAR RKFHGLPNSL MRRASKTWLG PNKCTSKPAG RGTLLAPSLY FYYVDQFRQW  60
FTEYEPPSLK GTTLQEPLCS ARRRRACRRL MEDLAEVLTE FHPSTGKVPH LDTLSQAHLP  120
IARELPNNDS LRLEEYLSAG SFAVLDAALH SICESQATLP ETNAGSSAPS SYYHSHQDQN  180
ALTGQGTNPM LATRQGFTSG QLAASTTGQT LQQQTQQHQQ QQQEHQHRQA ADGGQAAASG  240
TGSSGLFPRQ MNPQLAQPPT PQQQQQQQPS QHQLQELQHQ HLHQHQHQHQ HQQHQQQQQQ  300
QLLQGTRTSP AQQPSAPAQQ PQQQHSLQNH QQQQQQHQQH QQQKRPSLAS GGAACSRGPS  360
RSESNSNGSN QISRDATVPP PHESSTGESG PRADSGPMEV QVARATGATA AAVVTTVAAG  420
AAGGGGGSGA SGSRGDGHVA SGPAAGPAGG ASDQTHPPPP PPEVSTPPAE GRKLREEEQR  480
DVEEFVNLAW NANYKQGDAV RLEFTGPNVG ARTTGRLMAA ATAQLMRRGV AAAQAGQITG  540
LNTSIRSAME RHLPVKRDKA HLEGDKGTEL LTEALRHITE QLMSRGVDPR SIIENHSNGT  600
PPGGGGAATA VAAAAAAANG GAGGSKTSLG SIGDNSADTA GLKLPSPPPV AAGAMVGMPP  660
PGGAMDLIQL QQQQQLQQQL QLQMQMQQAP QFQQLMLEAT REHHQPTGPM GSTGGPPLVD  720
YGGFFSPTGE TGPVGVPAAG GGVSDILQEA FRAFAAEQEA AAVAAAAAAA AAEGGDGSGG  780
DMGATATMMD FQAAAAAAAS SVLPNAATAA VPLYQRTTCS VTMIDVGHDE SELSSPHAAA  840
AAAAAAAAAA AAGGTLLSEG MQGACGPPGF RSGQWIPTGR SMVGGKAATL PSSSSSLQTT  900
ASAAAAAAAA AAAALPHQQQ QQMLHHSAAA GCAAGGMMSS FGGPPTCISP PPGPETSDKR  960
PLSPSRFDTG SPHRLSNAMS ILRNRSADLG SLDMIMSNDY FMDGVDPLLN DGRQPSIADK  1020
FLMYIDGGGH PGMQPGGLIG LASGFPLGPI PSGTAGDAAA AAAAATAGGP QRQLPAAGLH  1080
SSGAGGAGGS ASAAAVDVFQ NPHMPQAAVD GTCGGDATPG GGGGGGGGGG GNCLMGQDPR  1140
MIVYDMDAMM RSQAPTAFGG GVGVTTSAKP QSFCRPSDNT LNTGNGSHTR EPLPSVDGGG  1200
SPAAPFGSSF AFAMAQYGNC PAADGGGDVG SVDGLARITS APPGVLGDES AFCPRMSSAH  1260
AHGLSMAHGK GMSYSVPYSH GQGHPLAMNS APAIWTGLGD SNLGGMDVYS MEHMGMPAPP  1320
GSAVERQQQV RQLQQQQQLQ LEQLQQEQQQ QQQQQLQQQQ LQQHQHQQQQ QLFAQLFPGA  1380
QQAVCGGGGG SAGGSSISIS PSTMMSPTGN SPVMHFMPTS FPPQRDDSGC LSIGHKAHML  1440
PRISTAVGLP PHFQPPPSPP SVVRNMRGGC AAANSVRAGG GAAAAAAAGQ APARSPRSSA  1500
PGTPRSPRAP ATGTPRSRTK AGCTPLSAPS PGAVKAQLDE MMRVDPVAAA AAAAGGGSGM  1560
SESLAAAAAA AAVAAVAAAP EAALAAAAAA GLIVAEDAGA AVDSPGASGG GNLRRSRREA  1620
RGARGSTLGT ARTGRGGRSR GTDDDDEDYA TDADEDALSS DDGDDEGGGG GGGAGRGGGG  1680
GGGGTTSGEG YVDEDSVLVV RAVRDGVRRE ITKSALRKVY HLPINEAAAA LNIGVTVLKK  1740
YCRKFRVPRW PYRKLQSMAK LIESFERYKK NAFSNGDIEG AADCQDVIDR LLKFREEVYD  1800
NPDKDIDESV KKLRQANFKI EYRQRQGQTQ GAPPSTLTRS SLNGETPGAA TGVGGAPSSH  1860
DLRRDFETLS VNAASAEVTE PPPA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002954587.10.0RWP-RK domain-containing transcription factor
TrEMBLD8U7F80.0D8U7F8_VOLCA; RWP-RK domain-containing transcription factor
STRINGXP_002954587.10.0(Volvox carteri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP841650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.15e-20RWP-RK domain-containing protein