PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vocar.0001s1700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Volvox
Family Nin-like
Protein Properties Length: 811aa    MW: 85176.3 Da    PI: 7.0415
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vocar.0001s1700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK61.12e-19696744452
               RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           ++le+l+ +F+lp +d+ + Lg+++T LKr+CR +GI+RWPhRk++sl
  Vocar.0001s1700.1.p 696 ALTLETLRGMFELPAQDVVRALGISATDLKRRCRALGIRRWPHRKLASL 744
                          799*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.768682764IPR003035RWP-RK domain
PfamPF020426.2E-18697744IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 811 aa     Download sequence    Send to blast
MLSCGAHLGG PARPLSMMAA KARTDNEGCG FPSMSYSYER YPQTGCAFAP EEMSVMEDFV  60
TCGGSDAPAS RAAAELGPAF AANFVSSSAH LYTSSHCARE APLASRASGQ PPSSSYQLGT  120
YMRVQDVSSL AAAADGRYVH PSNLSTGLPA GFTSPSQQQV VPSGPNFGYE PKRPAASVEL  180
PSQNIFRSHQ YYHHHHHHHH HHQQQQQQQQ QPSHQPASRG TLGAALSLPS PAPALMMPWP  240
WSQSSSALSF SPPAHQHHPI PLMSFSAEAR LPQGLSGWHP DSGMDLGLEE QLYAEIEAAP  300
WPIVQHPPAP PLSLHASAFP AGGEAHRQLQ QQQFRQQGRQ LHHHHQQQLQ QRQEFKQLQQ  360
QQQQQQQHRF EQLGLQQQQQ QQQEAPNRFS VPFPCQSAGA MATVPRDGAD PTTAAVATLP  420
PPPPPPLPHA ASPPAATNGR NDSSITAIPC QPNPTVTTEL LLCHQFECGA TMGGVSTPEQ  480
QPPPPPPAWA RVPMAPPLLP TAAAPCPSAA VGTITSTAAG GTCVAISAAD ISMDDPMSLC  540
TAYSGGRLCN PRQQQRLQSS TSGMIAASPC AAELAAAAAA TGYSAHKTSD TDMLPAVASA  600
VAAAGSPDAG GSGAGGGGAL TGTAATGGLP AAITTKDIGD CPEVLGAEGP SGGALCCDAA  660
AAAAEPPGQL TRSTRVVGGD GGGGGVHVVG RIPRNALTLE TLRGMFELPA QDVVRALGIS  720
ATDLKRRCRA LGIRRWPHRK LASLQRLVQA VNEDVDLPAN EREVVLETVA ATRSRIFEDP  780
NVDLDSSLKV LRQVQYKRHF LERRGYGGSG *
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP841650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-16RWP-RK domain-containing protein