PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang11g18560.1 | ||||||||
Common Name | LR48_Vigan01g327100 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 133aa MW: 14663.6 Da PI: 6.2666 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 182.2 | 4.2e-57 | 19 | 114 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 reqdr+lPianv+rimkkvlP+nakisk++ket+qecvsefisfvt+easdkcq+ekrktingddllwa+a+lGfedy+eplk+yl+kyre+ege Vang11g18560.1 19 REQDRLLPIANVGRIMKKVLPGNAKISKESKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMASLGFEDYAEPLKAYLHKYREMEGE 113 89********************************************************************************************9 PP NF-YB 97 k 97 k Vang11g18560.1 114 K 114 8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.7E-53 | 14 | 117 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.11E-41 | 21 | 123 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.0E-27 | 24 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 9.4E-22 | 52 | 70 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 55 | 71 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 9.4E-22 | 71 | 89 | No hit | No description |
PRINTS | PR00615 | 9.4E-22 | 90 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MAESDNESGG GKNESSICRE QDRLLPIANV GRIMKKVLPG NAKISKESKE TMQECVSEFI 60 SFVTGEASDK CQKEKRKTIN GDDLLWAMAS LGFEDYAEPL KAYLHKYREM EGEKTAMIGK 120 HHGATGFYAN PL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-47 | 19 | 109 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-47 | 19 | 109 | 2 | 92 | Transcription factor HapC (Eurofung) |
5g49_A | 3e-47 | 19 | 109 | 7 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang11g18560.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 0.0 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017427439.1 | 8e-95 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 4e-64 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A0L9TT48 | 6e-94 | A0A0L9TT48_PHAAN; Uncharacterized protein | ||||
STRING | XP_007154047.1 | 1e-92 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF591 | 34 | 150 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 2e-66 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|