PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang11g18210.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 248aa MW: 29022.3 Da PI: 6.6934 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 161.8 | 2.5e-50 | 53 | 178 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d+ + +++ Vang11g18210.1 53 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRTEN 146 79***************************.89***************8778899***************************************** PP NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 + +glkktLvfy+g+apkg +t+W+m+eyrl Vang11g18210.1 147 FRSIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 178 ******************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 51.087 | 52 | 194 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 9.55E-53 | 52 | 185 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.3E-25 | 54 | 178 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 248 aa Download sequence Send to blast |
MAIAAANSSP TMSLSQSQSQ EDVTTTSTTN DNTNSNNNNN DNKPDDHEHD MVMPGFRFHP 60 TEEELVEFYL RRKVEGKRFN VELITFLDLY RYDPWELPAL AAIGEKEWYF YVPRDRKYRN 120 GDRPNRVTTS GYWKATGADR MIRTENFRSI GLKKTLVFYS GKAPKGIRTS WIMNEYRLPQ 180 HETERYQKQQ YYNVQSHPNQ FSTLLMQPSP VVSLSSLPNP LPTTFSDRLW EWNPIPEPPN 240 QEYSNMSF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-54 | 54 | 178 | 19 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-54 | 54 | 178 | 19 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-54 | 54 | 178 | 19 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-54 | 54 | 178 | 19 | 142 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-54 | 54 | 178 | 22 | 145 | NAC domain-containing protein 19 |
3swm_B | 5e-54 | 54 | 178 | 22 | 145 | NAC domain-containing protein 19 |
3swm_C | 5e-54 | 54 | 178 | 22 | 145 | NAC domain-containing protein 19 |
3swm_D | 5e-54 | 54 | 178 | 22 | 145 | NAC domain-containing protein 19 |
3swp_A | 5e-54 | 54 | 178 | 22 | 145 | NAC domain-containing protein 19 |
3swp_B | 5e-54 | 54 | 178 | 22 | 145 | NAC domain-containing protein 19 |
3swp_C | 5e-54 | 54 | 178 | 22 | 145 | NAC domain-containing protein 19 |
3swp_D | 5e-54 | 54 | 178 | 22 | 145 | NAC domain-containing protein 19 |
4dul_A | 5e-54 | 54 | 178 | 19 | 142 | NAC domain-containing protein 19 |
4dul_B | 5e-54 | 54 | 178 | 19 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00257 | DAP | Transfer from AT2G02450 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang11g18210.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 1e-164 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003550460.1 | 1e-123 | NAC domain-containing protein 35 | ||||
Refseq | XP_028209593.1 | 1e-123 | NAC domain-containing protein 35-like | ||||
Swissprot | Q9ZVP8 | 9e-94 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
TrEMBL | A0A445FZS3 | 1e-122 | A0A445FZS3_GLYSO; NAC domain-containing protein 35 isoform A | ||||
TrEMBL | K7MJ70 | 1e-122 | K7MJ70_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA17G00650.2 | 1e-122 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF7203 | 31 | 46 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.1 | 2e-94 | NAC domain containing protein 35 |
Publications ? help Back to Top | |||
---|---|---|---|
|