PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang11g17360.3

Common Name

LR48_Vigan01g308200

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

NF-YB

Protein Properties

Length: 100aa MW: 11476.9 Da PI: 5.9472

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang11g17360.3	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	141.5	2.1e-44	1	81	17	97
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 mk++lP nakisk++ket+qecvsefisfvtseas+kc++e+rkt+ngdd++wal++lGf+dy++pl+ yl++yrele ++ Vang11g17360.3 1 MKQILPPNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDICWALGSLGFDDYADPLRRYLHRYRELEVDR 81 9*****************************************************************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF47113	2.51E-31	1	96	IPR009072	Histone-fold
Pfam	PF00808	1.0E-20	1	55	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
Gene3D	G3DSA:1.10.20.10	7.2E-41	1	95	IPR009072	Histone-fold
PRINTS	PR00615	2.5E-18	19	37	No hit	No description
PROSITE pattern	PS00685	0	22	38	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	2.5E-18	38	56	No hit	No description
PRINTS	PR00615	2.5E-18	57	75	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 100 aa Download sequence Send to blast
MKQILPPNAK ISKESKETMQ ECVSEFISFV TSEASEKCRK ERRKTVNGDD ICWALGSLGF 60 DDYADPLRRY LHRYRELEVD RSAIQERGNS PSKDKDAEF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-34	1	76	17	92	Transcription factor HapC (Eurofung)
4g92_B	1e-34	1	76	17	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang11g17360.3

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015034	1e-167	AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017419994.1	7e-69	PREDICTED: nuclear transcription factor Y subunit B-5-like
Swissprot	O82248	3e-43	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBL	A0A0L9TSQ6	2e-67	A0A0L9TSQ6_PHAAN; Uncharacterized protein
TrEMBL	A0A0S3R9T8	2e-67	A0A0S3R9T8_PHAAN; Uncharacterized protein
STRING	XP_007154257.1	7e-66	(Phaseolus vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	2e-37	nuclear factor Y, subunit B5

Publications ? help Back to Top
Yang K, et al. Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8 [PMID:26460024] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]