PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang11g17360.2 | ||||||||
Common Name | LR48_Vigan01g308200 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 110aa MW: 12524.2 Da PI: 7.1892 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 163 | 4.3e-51 | 2 | 91 | 8 | 97 |
NF-YB 8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 lPianv+rimk++lP nakisk++ket+qecvsefisfvtseas+kc++e+rkt+ngdd++wal++lGf+dy++pl+ yl++yrele ++ Vang11g17360.2 2 LPIANVGRIMKQILPPNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDICWALGSLGFDDYADPLRRYLHRYRELEVDR 91 9**************************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 9.6E-48 | 1 | 105 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.43E-37 | 1 | 106 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.5E-27 | 2 | 65 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.9E-18 | 29 | 47 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 32 | 48 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.9E-18 | 48 | 66 | No hit | No description |
PRINTS | PR00615 | 2.9E-18 | 67 | 85 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
LLPIANVGRI MKQILPPNAK ISKESKETMQ ECVSEFISFV TSEASEKCRK ERRKTVNGDD 60 ICWALGSLGF DDYADPLRRY LHRYRELEVD RSAIQERGNS PSKDKDAEF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-41 | 2 | 86 | 8 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-41 | 2 | 86 | 8 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang11g17360.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 0.0 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017419994.1 | 1e-76 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 3e-51 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A0L9TSQ6 | 3e-75 | A0A0L9TSQ6_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3R9T8 | 3e-75 | A0A0S3R9T8_PHAAN; Uncharacterized protein | ||||
STRING | XP_007154257.1 | 1e-73 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 2e-45 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|