PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang10g04090.4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 158aa MW: 18027 Da PI: 5.7149 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 148.2 | 1.7e-46 | 1 | 81 | 17 | 97 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 mkkv+P+n+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++tlGfedyveplk+yl+ky+e+egek Vang10g04090.4 1 MKKVIPSNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDVIWAITTLGFEDYVEPLKIYLQKYKEIEGEK 81 9*****************************************************************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 9.43E-34 | 1 | 108 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.2E-20 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 4.8E-44 | 1 | 112 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 7.9E-21 | 19 | 37 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.9E-21 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 7.9E-21 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MKKVIPSNGK ISKDAKETVQ ECVSEFISFV TGEASDKCQR EKRKTINGDD VIWAITTLGF 60 EDYVEPLKIY LQKYKEIEGE KLNIPKQLRS EQRLQQHQQN NSNSSQDDNN QQFNGAYAST 120 NLISQPPYVT SDQKFPLPFS PNSIQNHQID SVGHWYE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 1e-36 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-36 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang10g04090.4 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 0.0 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014523794.1 | 1e-114 | nuclear transcription factor Y subunit B-3 | ||||
Refseq | XP_017405393.1 | 1e-114 | PREDICTED: nuclear transcription factor Y subunit B-7 | ||||
Swissprot | Q9SIT9 | 7e-55 | NFYB7_ARATH; Nuclear transcription factor Y subunit B-7 | ||||
TrEMBL | A0A0S3QY27 | 1e-113 | A0A0S3QY27_PHAAN; Uncharacterized protein | ||||
STRING | XP_007159859.1 | 1e-106 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G13570.1 | 9e-54 | nuclear factor Y, subunit B7 |
Publications ? help Back to Top | |||
---|---|---|---|
|