PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang10g04090.2 | ||||||||
Common Name | LR48_Vigan01g012100 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 206aa MW: 23450.7 Da PI: 5.9444 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 180.3 | 1.7e-56 | 34 | 129 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 +eqdrflPianv+rimkkv+P+n+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++tlGfedyveplk+yl+ky+e+ege Vang10g04090.2 34 KEQDRFLPIANVGRIMKKVIPSNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDVIWAITTLGFEDYVEPLKIYLQKYKEIEGE 128 89*******************************************************************************************99 PP NF-YB 97 k 97 k Vang10g04090.2 129 K 129 6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 9.0E-55 | 27 | 160 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.8E-41 | 36 | 155 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.4E-27 | 39 | 103 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.4E-20 | 67 | 85 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 70 | 86 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.4E-20 | 86 | 104 | No hit | No description |
PRINTS | PR00615 | 1.4E-20 | 105 | 123 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 206 aa Download sequence Send to blast |
MEDESHNTLP NGFNSASPNN NINNNHNNNN NHNKEQDRFL PIANVGRIMK KVIPSNGKIS 60 KDAKETVQEC VSEFISFVTG EASDKCQREK RKTINGDDVI WAITTLGFED YVEPLKIYLQ 120 KYKEIEGEKL NIPKQLRSEQ RLQQHQQNNS NSSQDDNNQQ FNGAYASTNL ISQPPYVTSD 180 QKFPLPFSPN SIQNHQIDSV GHWYE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 1e-45 | 34 | 124 | 3 | 93 | NF-YB |
4awl_B | 1e-45 | 34 | 124 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-45 | 34 | 124 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4g91_B | 2e-45 | 34 | 124 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-45 | 34 | 124 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang10g04090.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 0.0 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017405393.1 | 1e-133 | PREDICTED: nuclear transcription factor Y subunit B-7 | ||||
Swissprot | Q9SIT9 | 2e-66 | NFYB7_ARATH; Nuclear transcription factor Y subunit B-7 | ||||
TrEMBL | A0A0L9TJH2 | 1e-132 | A0A0L9TJH2_PHAAN; Uncharacterized protein | ||||
STRING | XP_007159859.1 | 1e-122 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G13570.1 | 3e-65 | nuclear factor Y, subunit B7 |
Publications ? help Back to Top | |||
---|---|---|---|
|