PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang1097s00010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 98aa MW: 10830.2 Da PI: 7.3843 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 115.5 | 3.3e-36 | 11 | 88 | 1 | 78 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavg 78 +CaaCk++rrkC+++Cv+apyfp ++p++fa+vhk+FGasnv kll++l+ +red+++sl+yeAear+rdPvy av+ Vang1097s00010.1 11 PCAACKIQRRKCTQECVFAPYFPPDNPQRFAYVHKVFGASNVAKLLNELNAAQREDVVKSLAYEAEARLRDPVYEAVE 88 7*************************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 21.998 | 10 | 97 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.9E-36 | 11 | 88 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 98 aa Download sequence Send to blast |
MSSSLSSSNS PCAACKIQRR KCTQECVFAP YFPPDNPQRF AYVHKVFGAS NVAKLLNELN 60 AAQREDVVKS LAYEAEARLR DPVYEAVESG HHWVALE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-37 | 2 | 87 | 2 | 87 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-37 | 2 | 87 | 2 | 87 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang1097s00010.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015038 | 1e-163 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017406472.1 | 4e-59 | PREDICTED: LOB domain-containing protein 6-like | ||||
Swissprot | Q9FKZ3 | 7e-43 | LBD36_ARATH; LOB domain-containing protein 36 | ||||
TrEMBL | A0A0S3REJ9 | 8e-58 | A0A0S3REJ9_PHAAN; Uncharacterized protein | ||||
STRING | GLYMA04G11991.1 | 2e-51 | (Glycine max) | ||||
STRING | GLYMA06G11181.1 | 2e-51 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2353 | 34 | 84 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66870.1 | 1e-42 | ASYMMETRIC LEAVES 2-like 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|