PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang08g00620.2
Organism
Vigna angularis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Trihelix
Protein Properties Length: 54aa    MW: 6661.69 Da    PI: 10.5144
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang08g00620.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix54.62.9e-172493886
        trihelix 38 mrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86
                    mr+ g++r++k+ kekwen+nk++k++ke++k+r  e+s+tcpyf+q++
  Vang08g00620.2  2 MRKLGYNRNAKRSKEKWENINKYFKEVKESNKRR-LEDSKTCPYFQQMD 49
                    899*****************************98.68889********8 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138374.0E-10250No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 54 aa     Download sequence    Send to blast
LMRKLGYNRN AKRSKEKWEN INKYFKEVKE SNKRRLEDSK TCPYFQQMDV LYR*
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that binds specific DNA sequence such as GT3 box 5'-GGTAAA-3' in the SDD1 promoter. Negative regulator of water use efficiency (WUE) via the promotion of stomatal density and distribution by the transcription repression of SDD1. Regulates the expression of several cell cycle genes and endoreduplication, especially in trichomes where it prevents ploidy-dependent plant cell growth. {ECO:0000269|PubMed:19717615, ECO:0000269|PubMed:21169508}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang08g00620.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by water stress. {ECO:0000269|PubMed:21169508}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150423e-85AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465995.24e-25trihelix transcription factor GTL1
SwissprotQ9C8824e-22GTL1_ARATH; Trihelix transcription factor GTL1
TrEMBLA0A0A9NHJ64e-24A0A0A9NHJ6_ARUDO; Uncharacterized protein
STRINGXP_002532429.12e-24(Ricinus communis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-26Trihelix family protein
Publications ? help Back to Top
  1. Caro E,Desvoyes B,Gutierrez C
    GTL1 keeps cell growth and nuclear ploidy under control.
    EMBO J., 2012. 31(24): p. 4483-5
    [PMID:23188085]
  2. Zheng X, et al.
    The Wheat GT Factor TaGT2L1D Negatively Regulates Drought Tolerance and Plant Development.
    Sci Rep, 2016. 6: p. 27042
    [PMID:27245096]
  3. Shibata M, et al.
    GTL1 and DF1 regulate root hair growth through transcriptional repression of ROOT HAIR DEFECTIVE 6-LIKE 4 in Arabidopsis.
    Development, 2018.
    [PMID:29439132]