PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang06g17820.3 | ||||||||
Common Name | LR48_Vigan02g107600 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 98aa MW: 11131.5 Da PI: 6.5132 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 147.9 | 2.1e-46 | 1 | 81 | 17 | 97 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 mk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++walatlGf+dy+eplk yl+kyrelege+ Vang06g17820.3 1 MKQTLPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALATLGFDDYAEPLKRYLHKYRELEGER 81 9******************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.1E-43 | 1 | 88 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.37E-33 | 1 | 87 | IPR009072 | Histone-fold |
Pfam | PF00808 | 9.2E-22 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.4E-21 | 19 | 37 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 6.4E-21 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 6.4E-21 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 98 aa Download sequence Send to blast |
MKQTLPPNAK ISKEAKETMQ ECVSEFISFV TGEASDKCHK EKRKTVNGDD ICWALATLGF 60 DDYAEPLKRY LHKYRELEGE RATQNKSNTY ENNIANI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-35 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-35 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang06g17820.3 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015041 | 1e-163 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017413038.1 | 3e-68 | PREDICTED: nuclear transcription factor Y subunit B-5 | ||||
Swissprot | O82248 | 8e-48 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A0L9TWP1 | 7e-67 | A0A0L9TWP1_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3SS71 | 7e-67 | A0A0S3SS71_PHAAN; Uncharacterized protein | ||||
STRING | XP_007144547.1 | 9e-64 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 3e-50 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|