PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang06g12890.1 | ||||||||
Common Name | LR48_Vigan10g089200 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 91aa MW: 10211.4 Da PI: 9.5054 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 56 | 9.8e-18 | 1 | 42 | 56 | 97 |
NF-YB 56 rekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +e+rkt+ngdd++wal++lGf++y+e++ yl+kyr++e+ek Vang06g12890.1 1 KENRKTVNGDDICWALSSLGFDNYAEAIARYLHKYRQAEREK 42 79*************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 7.18E-13 | 1 | 51 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 4.5E-17 | 1 | 56 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
KENRKTVNGD DICWALSSLG FDNYAEAIAR YLHKYRQAER EKIQNNNKKY EGSATKSLNQ 60 TQLILAPPPP PSLSRVTHDK LQNPPTTDQS * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang06g12890.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015041 | 1e-151 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014511823.1 | 2e-56 | nuclear transcription factor Y subunit B-4 | ||||
Swissprot | O04027 | 7e-20 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A0L9VIY1 | 1e-60 | A0A0L9VIY1_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3SQC7 | 1e-60 | A0A0S3SQC7_PHAAN; Uncharacterized protein | ||||
STRING | XP_007144936.1 | 6e-36 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 5e-22 | nuclear factor Y, subunit B4 |
Publications ? help Back to Top | |||
---|---|---|---|
|