PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang06g10140.8 | ||||||||
Common Name | LR48_Vigan10g091700 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 157aa MW: 17740.3 Da PI: 5.2318 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 143.6 | 4.8e-45 | 1 | 79 | 23 | 101 |
NF-YC 23 larikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101 larikki+kadedv+misaeaPv++++ace+fileltlrsw+h+eenkr+tl+k+diaaa+trtdifdflvdivpr++ Vang06g10140.8 1 LARIKKIMKADEDVRMISAEAPVIFARACEMFILELTLRSWNHTEENKRKTLQKNDIAAAITRTDIFDFLVDIVPREDY 79 79**************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.3E-36 | 1 | 76 | IPR009072 | Histone-fold |
Pfam | PF00808 | 8.4E-20 | 1 | 61 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 2.58E-26 | 2 | 77 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005829 | Cellular Component | cytosol | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
LARIKKIMKA DEDVRMISAE APVIFARACE MFILELTLRS WNHTEENKRK TLQKNDIAAA 60 ITRTDIFDFL VDIVPREDYK DEVLASMPRG TVPVTAPPEA LPYCYMPPQH AQVGAAGVMM 120 SNKTVMDPYA QQSHQYNMAQ QMWPQPPEQQ QSSSDQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 3e-49 | 1 | 76 | 20 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Interacts with REF6 to directly regulate SOC1 transcription in response to flowering signals from photoperiod and gibberellic acid pathways (PubMed:25105952). {ECO:0000250, ECO:0000269|PubMed:25105952}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang06g10140.8 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015041 | 0.0 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017438109.1 | 1e-114 | PREDICTED: nuclear transcription factor Y subunit C-3-like | ||||
Swissprot | Q8L4B2 | 6e-65 | NFYC9_ARATH; Nuclear transcription factor Y subunit C-9 | ||||
TrEMBL | A0A0L9VJ03 | 1e-113 | A0A0L9VJ03_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3SQI3 | 1e-113 | A0A0S3SQI3_PHAAN; Uncharacterized protein | ||||
STRING | XP_007144748.1 | 1e-104 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08970.4 | 2e-66 | nuclear factor Y, subunit C9 |