PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang05g08590.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 121aa MW: 13690.2 Da PI: 10.8834 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 68.4 | 2e-21 | 2 | 53 | 75 | 127 |
NAM 75 nratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127 nr t++gyWkatgk+++++s +++l+g+kk+Lvfy grapk +kt+Wvmheyr Vang05g08590.3 2 NRGTTHGYWKATGKNQKIKS-GSALIGMKKILVFYIGRAPKEKKTNWVMHEYR 53 788999**************.9******************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 24.134 | 1 | 70 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 8.11E-23 | 2 | 60 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.8E-11 | 2 | 53 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
LNRGTTHGYW KATGKNQKIK SGSALIGMKK ILVFYIGRAP KEKKTNWVMH EYRPTLKELD 60 GTNLGQVYSY LLLLLFGIFA FSSLLPWCFD IKLFVSFNSS IVFFPSRGVL TRGRSKHLSL 120 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-15 | 2 | 53 | 90 | 141 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-15 | 2 | 53 | 90 | 141 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-15 | 2 | 53 | 90 | 141 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-15 | 2 | 53 | 90 | 141 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-15 | 2 | 53 | 93 | 144 | NAC domain-containing protein 19 |
3swm_B | 5e-15 | 2 | 53 | 93 | 144 | NAC domain-containing protein 19 |
3swm_C | 5e-15 | 2 | 53 | 93 | 144 | NAC domain-containing protein 19 |
3swm_D | 5e-15 | 2 | 53 | 93 | 144 | NAC domain-containing protein 19 |
3swp_A | 5e-15 | 2 | 53 | 93 | 144 | NAC domain-containing protein 19 |
3swp_B | 5e-15 | 2 | 53 | 93 | 144 | NAC domain-containing protein 19 |
3swp_C | 5e-15 | 2 | 53 | 93 | 144 | NAC domain-containing protein 19 |
3swp_D | 5e-15 | 2 | 53 | 93 | 144 | NAC domain-containing protein 19 |
4dul_A | 5e-15 | 2 | 53 | 90 | 141 | NAC domain-containing protein 19 |
4dul_B | 5e-15 | 2 | 53 | 90 | 141 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269|PubMed:17947243, ECO:0000269|PubMed:18443413, ECO:0000269|PubMed:22826500, ECO:0000269|PubMed:24329768}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang05g08590.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015035 | 0.0 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017430850.1 | 3e-35 | PREDICTED: protein NTM1-like 9 isoform X1 | ||||
Refseq | XP_017430852.1 | 3e-35 | PREDICTED: protein NTM1-like 9 isoform X2 | ||||
Refseq | XP_028795774.1 | 6e-35 | protein NTM1-like 9 | ||||
Swissprot | F4JN35 | 3e-28 | NTL9_ARATH; Protein NTM1-like 9 | ||||
TrEMBL | A0A0L9UZJ9 | 8e-34 | A0A0L9UZJ9_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3RLR7 | 8e-34 | A0A0S3RLR7_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A392R1P7 | 1e-34 | A0A392R1P7_9FABA; NAC domain protein (Fragment) | ||||
STRING | XP_004502779.1 | 3e-33 | (Cicer arietinum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G35580.3 | 6e-30 | NAC transcription factor-like 9 |
Publications ? help Back to Top | |||
---|---|---|---|
|