PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang03g04600.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MIKC_MADS
Protein Properties Length: 323aa    MW: 36771.2 Da    PI: 9.7144
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang03g04600.3genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF862.2e-2752101251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                     ri+n++ rqvtfskRrng+lKKA ELS+LCdaev +++fsstgkly+y+s
  Vang03g04600.3  52 RIDNSTSRQVTFSKRRNGLLKKARELSILCDAEVGLMVFSSTGKLYDYAS 101
                     8***********************************************86 PP

2K-box71.33e-24123224999
           K-box   9 leeakaeslqqelakLkkeienLq...........reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                     + +++++ +q+e+a+L+ +++ Lq            + R+l+Ge+L+ L +keLq+Le+qLe slk +R kK+++l+++i+el++k + ++++n 
  Vang03g04600.3 123 NPASEEKFWQTEAANLRTQLQYLQechsisifvsfGNSRQLMGEELTGLGIKELQNLENQLEMSLKGVRMKKDQILTSEIKELRQKGNLIHQDNV 217
                     5678899*****************99888888888788********************************************************* PP

           K-box  93 aLrkkle 99 
                     +L +k++
  Vang03g04600.3 218 ELYQKMD 224
                     ****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-4043102IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.08543103IPR002100Transcription factor, MADS-box
CDDcd002658.40E-4444119No hitNo description
SuperFamilySSF554551.26E-3244132IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-284565IPR002100Transcription factor, MADS-box
PROSITE patternPS0035004599IPR002100Transcription factor, MADS-box
PfamPF003197.0E-255299IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-286580IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-2880101IPR002100Transcription factor, MADS-box
PfamPF014861.8E-19125223IPR002487Transcription factor, K-box
PROSITE profilePS5129713.607128229IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MYNSIASCNS PRIRNIHLRK SCPSSPSLLC FSLITTHSHN FQMGRGKIAI RRIDNSTSRQ  60
VTFSKRRNGL LKKARELSIL CDAEVGLMVF SSTGKLYDYA STSMKSVFER YNKLKEEHHH  120
LMNPASEEKF WQTEAANLRT QLQYLQECHS ISIFVSFGNS RQLMGEELTG LGIKELQNLE  180
NQLEMSLKGV RMKKDQILTS EIKELRQKGN LIHQDNVELY QKMDQIQKEN AELQKKVFGS  240
RSTGEENVAS SPSYMVRNEY ELRPPISLQL SQPQTQYSEP SAKIAAALAK NCSVNGDLSF  300
CDKKQLLQLL PRMVRLSTSW VL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A8e-2243123181MEF2C
5f28_B8e-2243123181MEF2C
5f28_C8e-2243123181MEF2C
5f28_D8e-2243123181MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang03g04600.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0968101e-135BT096810.1 Soybean clone JCVI-FLGm-25F18 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017436232.11e-166PREDICTED: MADS-box transcription factor 23-like isoform X2
SwissprotQ6EP491e-88MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A0S3S2761e-165A0A0S3S276_PHAAN; Uncharacterized protein
STRINGGLYMA13G32810.11e-143(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.12e-89AGAMOUS-like 21
Publications ? help Back to Top
  1. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  2. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]