PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang0326s00020.7 | ||||||||
Common Name | LR48_Vigan05g112000 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 156aa MW: 17869.4 Da PI: 10.5817 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 34.5 | 4.5e-11 | 8 | 49 | 9 | 50 |
CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 9 rkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 r NR +A+rsR RK+++i eLe+ v +L++e +aL ++ Vang0326s00020.7 8 RILANRQSAQRSRVRKLQYISELERSVTTLQTEVSALSPRVA 49 6778*****************************999987765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.7E-7 | 2 | 64 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 9.14E-11 | 7 | 58 | No hit | No description |
Pfam | PF00170 | 7.8E-9 | 8 | 49 | IPR004827 | Basic-leucine zipper domain |
PROSITE pattern | PS00036 | 0 | 8 | 22 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 4.0E-13 | 8 | 55 | No hit | No description |
CDD | cd14703 | 9.80E-18 | 8 | 55 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
LLLCMHIRIL ANRQSAQRSR VRKLQYISEL ERSVTTLQTE VSALSPRVAF LDHQRLILNV 60 DNSALKQRIA ALAQDKIFKD AHQEALKKEI ERLRQIYHQQ NLQKMSNTLN NNLQNPSTSQ 120 PQATIQSHSL HQHQHQQQIA VSQPLGCKDK EQLLS* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator. {ECO:0000269|PubMed:17719007}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang0326s00020.7 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015040 | 1e-124 | AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017424225.1 | 1e-101 | PREDICTED: basic leucine zipper 34-like | ||||
Swissprot | Q9M2K4 | 2e-59 | BZP61_ARATH; Basic leucine zipper 61 | ||||
TrEMBL | A0A0L9ULF3 | 1e-100 | A0A0L9ULF3_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3SIF7 | 1e-99 | A0A0S3SIF7_PHAAN; Uncharacterized protein | ||||
STRING | XP_007149416.1 | 4e-80 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58120.1 | 9e-62 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|