PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang02g08740.6 | ||||||||
Common Name | LR48_Vigan10g130700 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 106aa MW: 12327.2 Da PI: 10.7394 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 42.4 | 1.5e-13 | 4 | 62 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+ +NRe+ArrsR RK++ ++ L + v++L +eN++ +++ +++ ++++e+ Vang02g08740.6 4 RKKKRMTSNRESARRSRMRKQKHLDDLVTQVAQLRKENQQILTTVNITTQQFLSVEAEN 62 6899************************************9999998888877777666 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 4.6E-16 | 1 | 64 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.611 | 2 | 65 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 6.5E-12 | 3 | 79 | No hit | No description |
Pfam | PF00170 | 4.4E-11 | 4 | 48 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 5.06E-13 | 4 | 56 | No hit | No description |
CDD | cd14702 | 3.32E-17 | 5 | 55 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 7 | 22 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 106 aa Download sequence Send to blast |
MDQRKKKRMT SNRESARRSR MRKQKHLDDL VTQVAQLRKE NQQILTTVNI TTQQFLSVEA 60 ENSVLRAQVG ELSHRLESLN EIIELWLCVR RRGEDEVGIP TVPFL* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 3 | 24 | RKKKRMTSNRESARRSRMRKQK |
2 | 16 | 23 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:18088315, ECO:0000269|PubMed:21534971, ECO:0000269|PubMed:24861440}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang02g08740.6 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:15208401, ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015044 | 1e-178 | AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017438216.1 | 2e-70 | PREDICTED: bZIP transcription factor 11-like | ||||
Swissprot | O65683 | 4e-37 | BZP11_ARATH; bZIP transcription factor 11 | ||||
TrEMBL | A0A0L9T875 | 8e-69 | A0A0L9T875_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0L9VK41 | 2e-68 | A0A0L9VK41_PHAAN; Uncharacterized protein | ||||
STRING | XP_007131800.1 | 3e-49 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G34590.1 | 2e-39 | G-box binding factor 6 |