PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang0041ss00850.9 | ||||||||
Common Name | LR48_Vigan04g176800 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 35aa MW: 3934.6 Da PI: 5.5649 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 26.1 | 2.4e-08 | 2 | 32 | 17 | 48 |
NAM 17 eyLkkkvegkkleleevikevdiykvePwdLp 48 +yL++k++++++ + +i+e+d+yk++PwdLp Vang0041ss00850.9 2 HYLCRKCASQPIAV-PIIAEIDLYKYDPWDLP 32 8***********99.88**************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 6.02E-9 | 1 | 33 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 11.512 | 1 | 34 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009611 | Biological Process | response to wounding | ||||
GO:0009788 | Biological Process | negative regulation of abscisic acid-activated signaling pathway | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 35 aa Download sequence Send to blast |
MHYLCRKCAS QPIAVPIIAE IDLYKYDPWD LPGN* |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00121 | DAP | Transfer from AT1G01720 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang0041ss00850.9 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015035 | 2e-51 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014501798.1 | 2e-16 | NAC domain-containing protein 2 | ||||
Refseq | XP_017422406.1 | 3e-16 | PREDICTED: NAC domain-containing protein 2 | ||||
Refseq | XP_018853577.1 | 2e-16 | PREDICTED: NAC domain-containing protein 2-like | ||||
Swissprot | Q39013 | 1e-15 | NAC2_ARATH; NAC domain-containing protein 2 | ||||
TrEMBL | A0A2I4HBT5 | 4e-15 | A0A2I4HBT5_JUGRE; NAC domain-containing protein 2-like | ||||
STRING | XP_008466736.1 | 1e-15 | (Cucumis melo) | ||||
STRING | AES72289 | 1e-15 | (Medicago truncatula) | ||||
STRING | XP_007137423.1 | 1e-15 | (Phaseolus vulgaris) | ||||
STRING | XP_009795736.1 | 1e-15 | (Nicotiana sylvestris) | ||||
STRING | XP_009625026.1 | 1e-15 | (Nicotiana tomentosiformis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G01720.1 | 4e-18 | NAC family protein |