PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang0041ss00850.8 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 56aa MW: 6330.32 Da PI: 4.5093 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 62.2 | 1.6e-19 | 7 | 53 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 lppGfrFhPtdeelv++yL++k++++++ + +i+e+d+yk++PwdLp Vang0041ss00850.8 7 LPPGFRFHPTDEELVMHYLCRKCASQPIAV-PIIAEIDLYKYDPWDLP 53 79**************************99.88**************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.7E-21 | 3 | 54 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 22.459 | 7 | 55 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.1E-8 | 8 | 50 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009611 | Biological Process | response to wounding | ||||
GO:0009788 | Biological Process | negative regulation of abscisic acid-activated signaling pathway | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 56 aa Download sequence Send to blast |
MASELQLPPG FRFHPTDEEL VMHYLCRKCA SQPIAVPIIA EIDLYKYDPW DLPGN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 1e-24 | 3 | 53 | 11 | 61 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00121 | DAP | Transfer from AT1G01720 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang0041ss00850.8 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015035 | 8e-89 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007137423.1 | 1e-32 | hypothetical protein PHAVU_009G125900g | ||||
Refseq | XP_014501798.1 | 1e-32 | NAC domain-containing protein 2 | ||||
Refseq | XP_018853577.1 | 4e-33 | PREDICTED: NAC domain-containing protein 2-like | ||||
Refseq | XP_027355037.1 | 1e-32 | NAC domain-containing protein 2-like | ||||
Swissprot | Q39013 | 1e-29 | NAC2_ARATH; NAC domain-containing protein 2 | ||||
TrEMBL | A0A2I4HBT5 | 9e-32 | A0A2I4HBT5_JUGRE; NAC domain-containing protein 2-like | ||||
TrEMBL | A0A392NSU0 | 8e-32 | A0A392NSU0_9FABA; NAC domain-containing protein 2-like (Fragment) | ||||
TrEMBL | V7AUU2 | 3e-31 | V7AUU2_PHAVU; Uncharacterized protein | ||||
STRING | XP_007137423.1 | 5e-32 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G01720.1 | 5e-32 | NAC family protein |