PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang0039ss00910.2

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

MIKC_MADS

Protein Properties

Length: 212aa MW: 24287.8 Da PI: 10.0891

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang0039ss00910.2	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	100.2	7.9e-32	12	62	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+ Vang0039ss00910.2 12 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 62 79***********************************************95 PP
2	K-box	79.8	6.5e-27	79	168	3	92
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 +ss++ ++e +a+++qqe+akL+++i++Lq+++Rhl+G+ L++L++keL+qLe++Le+++++iRskK+ l ++ l+ k +++++++ Vang0039ss00910.2 79 HSSTSTTTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLTVKELKQLENRLERGITRIRSKKEIELENENLCLRTKITDVERIQQ 168 5666669999***********************************************************************999988765 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.3E-42	4	63	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	34.118	4	64	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.75E-33	5	82	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.86E-44	5	79	No hit	No description
PRINTS	PR00404	4.5E-33	6	26	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	6	60	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.1E-27	13	60	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.5E-33	26	41	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.5E-33	41	62	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	3.2E-19	87	164	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	12.539	90	183	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0048316	Biological Process	seed development
GO:0048481	Biological Process	plant ovule development
GO:0080155	Biological Process	regulation of double fertilization forming a zygote and endosperm
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 212 aa Download sequence Send to blast
LKNMGRGKIE IKRIENTTNR QVTFCKRRNG LLKKAYELSV LCDAEVALIV FSSRGRLYEY 60 SNNNIRSTIE RYKKACSDHS STSTTTEINA QYYQQESAKL RQQIQMLQNS NRHLMGDALS 120 TLTVKELKQL ENRLERGITR IRSKKEIELE NENLCLRTKI TDVERIQQVN MVSGPELNAI 180 QALASRNFFN PNMMEGGSVY PQSDKKILHL G*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-22	4	85	1	82	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-22	4	85	1	82	Myocyte-specific enhancer factor 2B
1tqe_R	1e-22	4	85	1	82	Myocyte-specific enhancer factor 2B
1tqe_S	1e-22	4	85	1	82	Myocyte-specific enhancer factor 2B
6c9l_A	1e-22	4	85	1	82	Myocyte-specific enhancer factor 2B
6c9l_B	1e-22	4	85	1	82	Myocyte-specific enhancer factor 2B
6c9l_C	1e-22	4	85	1	82	Myocyte-specific enhancer factor 2B
6c9l_D	1e-22	4	85	1	82	Myocyte-specific enhancer factor 2B
6c9l_E	1e-22	4	85	1	82	Myocyte-specific enhancer factor 2B
6c9l_F	1e-22	4	85	1	82	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269\|PubMed:21447172, ECO:0000269\|PubMed:29853599, ECO:0000269\|Ref.1}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang0039ss00910.2

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ371899	1e-158	DQ371899.1 Glycine max MADS domain transporter AGL11 (AGL11) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001236130.1	1e-146	MADS domain transporter AGL11
Refseq	XP_006580912.1	1e-146	MADS domain transporter AGL11 isoform X1
Refseq	XP_006580913.1	1e-146	MADS domain transporter AGL11 isoform X2
Refseq	XP_014631604.1	1e-146	MADS domain transporter AGL11 isoform X1
Refseq	XP_028238522.1	1e-146	agamous-like MADS-box protein AGL11
Refseq	XP_028238523.1	1e-146	agamous-like MADS-box protein AGL11
Refseq	XP_028238524.1	1e-146	agamous-like MADS-box protein AGL11
Swissprot	F6I457	1e-124	AG11C_VITVI; Agamous-like MADS-box protein AGL11
TrEMBL	A0A445KH22	1e-145	A0A445KH22_GLYSO; Agamous-like MADS-box protein AGL11 isoform A
TrEMBL	B9MSS8	1e-145	B9MSS8_SOYBN; MADS domain transporter AGL11
STRING	GLYMA06G48270.2	1e-145	(Glycine max)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09960.2	1e-115	MIKC_MADS family protein

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Mejía N, et al. Molecular, genetic and transcriptional evidence for a role of VvAGL11 in stenospermocarpic seedlessness in grapevine. BMC Plant Biol., 2011. 11: p. 57 [PMID:21447172] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Malabarba J, et al. The MADS-box gene Agamous-like 11 is essential for seed morphogenesis in grapevine. J. Exp. Bot., 2017. 68(7): p. 1493-1506 [PMID:28369525] Royo C, et al. The Major Origin of Seedless Grapes Is Associated with a Missense Mutation in the MADS-Box Gene VviAGL11. Plant Physiol., 2018. 177(3): p. 1234-1253 [PMID:29853599]