PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0039ss00910.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MIKC_MADS
Protein Properties Length: 212aa    MW: 24287.8 Da    PI: 10.0891
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0039ss00910.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.27.9e-321262151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  Vang0039ss00910.2 12 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 62
                       79***********************************************95 PP

2K-box79.86.5e-2779168392
              K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                        +ss++ ++e +a+++qqe+akL+++i++Lq+++Rhl+G+ L++L++keL+qLe++Le+++++iRskK+  l ++   l+ k  +++++++
  Vang0039ss00910.2  79 HSSTSTTTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLTVKELKQLENRLERGITRIRSKKEIELENENLCLRTKITDVERIQQ 168
                        5666669999***********************************************************************999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-42463IPR002100Transcription factor, MADS-box
PROSITE profilePS5006634.118464IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-33582IPR002100Transcription factor, MADS-box
CDDcd002654.86E-44579No hitNo description
PRINTSPR004044.5E-33626IPR002100Transcription factor, MADS-box
PROSITE patternPS003500660IPR002100Transcription factor, MADS-box
PfamPF003197.1E-271360IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-332641IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-334162IPR002100Transcription factor, MADS-box
PfamPF014863.2E-1987164IPR002487Transcription factor, K-box
PROSITE profilePS5129712.53990183IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
LKNMGRGKIE IKRIENTTNR QVTFCKRRNG LLKKAYELSV LCDAEVALIV FSSRGRLYEY  60
SNNNIRSTIE RYKKACSDHS STSTTTEINA QYYQQESAKL RQQIQMLQNS NRHLMGDALS  120
TLTVKELKQL ENRLERGITR IRSKKEIELE NENLCLRTKI TDVERIQQVN MVSGPELNAI  180
QALASRNFFN PNMMEGGSVY PQSDKKILHL G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-22485182Myocyte-specific enhancer factor 2B
1tqe_Q1e-22485182Myocyte-specific enhancer factor 2B
1tqe_R1e-22485182Myocyte-specific enhancer factor 2B
1tqe_S1e-22485182Myocyte-specific enhancer factor 2B
6c9l_A1e-22485182Myocyte-specific enhancer factor 2B
6c9l_B1e-22485182Myocyte-specific enhancer factor 2B
6c9l_C1e-22485182Myocyte-specific enhancer factor 2B
6c9l_D1e-22485182Myocyte-specific enhancer factor 2B
6c9l_E1e-22485182Myocyte-specific enhancer factor 2B
6c9l_F1e-22485182Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0039ss00910.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3718991e-158DQ371899.1 Glycine max MADS domain transporter AGL11 (AGL11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236130.11e-146MADS domain transporter AGL11
RefseqXP_006580912.11e-146MADS domain transporter AGL11 isoform X1
RefseqXP_006580913.11e-146MADS domain transporter AGL11 isoform X2
RefseqXP_014631604.11e-146MADS domain transporter AGL11 isoform X1
RefseqXP_028238522.11e-146agamous-like MADS-box protein AGL11
RefseqXP_028238523.11e-146agamous-like MADS-box protein AGL11
RefseqXP_028238524.11e-146agamous-like MADS-box protein AGL11
SwissprotF6I4571e-124AG11C_VITVI; Agamous-like MADS-box protein AGL11
TrEMBLA0A445KH221e-145A0A445KH22_GLYSO; Agamous-like MADS-box protein AGL11 isoform A
TrEMBLB9MSS81e-145B9MSS8_SOYBN; MADS domain transporter AGL11
STRINGGLYMA06G48270.21e-145(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.21e-115MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Mejía N, et al.
    Molecular, genetic and transcriptional evidence for a role of VvAGL11 in stenospermocarpic seedlessness in grapevine.
    BMC Plant Biol., 2011. 11: p. 57
    [PMID:21447172]
  4. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]
  5. Malabarba J, et al.
    The MADS-box gene Agamous-like 11 is essential for seed morphogenesis in grapevine.
    J. Exp. Bot., 2017. 68(7): p. 1493-1506
    [PMID:28369525]
  6. Royo C, et al.
    The Major Origin of Seedless Grapes Is Associated with a Missense Mutation in the MADS-Box Gene VviAGL11.
    Plant Physiol., 2018. 177(3): p. 1234-1253
    [PMID:29853599]