PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang0039ss00910.1 | ||||||||
Common Name | LR48_Vigan05g051800 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 226aa MW: 26076.9 Da PI: 9.9179 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 100.1 | 8.9e-32 | 12 | 62 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+ Vang0039ss00910.1 12 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 62 79***********************************************95 PP | |||||||
2 | K-box | 108.9 | 5.7e-36 | 79 | 175 | 3 | 99 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 +ss++ ++e +a+++qqe+akL+++i++Lq+++Rhl+G+ L++L++keL+qLe++Le+++++iRskK+e+ll++ie+ qk+e el++en +L Vang0039ss00910.1 79 HSSTSTTTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLTVKELKQLENRLERGITRIRSKKHEMLLAEIEYFQKREIELENENLCL 170 5666669999********************************************************************************** PP K-box 95 rkkle 99 r+k+ Vang0039ss00910.1 171 RTKIT 175 **986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.3E-42 | 4 | 63 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 34.118 | 4 | 64 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.14E-33 | 5 | 82 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.91E-44 | 5 | 79 | No hit | No description |
PRINTS | PR00404 | 5.2E-33 | 6 | 26 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 6 | 60 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.9E-27 | 13 | 60 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.2E-33 | 26 | 41 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.2E-33 | 41 | 62 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.1E-26 | 87 | 174 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.159 | 90 | 180 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048316 | Biological Process | seed development | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 226 aa Download sequence Send to blast |
LKNMGRGKIE IKRIENTTNR QVTFCKRRNG LLKKAYELSV LCDAEVALIV FSSRGRLYEY 60 SNNNIRSTIE RYKKACSDHS STSTTTEINA QYYQQESAKL RQQIQMLQNS NRHLMGDALS 120 TLTVKELKQL ENRLERGITR IRSKKHEMLL AEIEYFQKRE IELENENLCL RTKITDVERI 180 QQVNMVSGPE LNAIQALASR NFFNPNMMEG GSVYPQSDKK ILHLG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-22 | 4 | 85 | 1 | 82 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-22 | 4 | 85 | 1 | 82 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-22 | 4 | 85 | 1 | 82 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-22 | 4 | 85 | 1 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_A | 2e-22 | 4 | 85 | 1 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-22 | 4 | 85 | 1 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-22 | 4 | 85 | 1 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-22 | 4 | 85 | 1 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-22 | 4 | 85 | 1 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-22 | 4 | 85 | 1 | 82 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang0039ss00910.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ371899 | 0.0 | DQ371899.1 Glycine max MADS domain transporter AGL11 (AGL11) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007148609.1 | 1e-164 | hypothetical protein PHAVU_005G000900g | ||||
Refseq | XP_007148610.1 | 1e-164 | hypothetical protein PHAVU_005G000900g | ||||
Refseq | XP_007148611.1 | 1e-164 | hypothetical protein PHAVU_005G000900g | ||||
Refseq | XP_014523267.1 | 1e-164 | agamous-like MADS-box protein AGL11 | ||||
Refseq | XP_017425598.1 | 1e-164 | PREDICTED: agamous-like MADS-box protein AGL11 | ||||
Refseq | XP_017425599.1 | 1e-164 | PREDICTED: agamous-like MADS-box protein AGL11 | ||||
Refseq | XP_022632367.1 | 1e-164 | agamous-like MADS-box protein AGL11 | ||||
Refseq | XP_022632368.1 | 1e-164 | agamous-like MADS-box protein AGL11 | ||||
Refseq | XP_027921533.1 | 1e-164 | agamous-like MADS-box protein AGL11 | ||||
Refseq | XP_027921542.1 | 1e-164 | agamous-like MADS-box protein AGL11 | ||||
Refseq | XP_027921550.1 | 1e-164 | agamous-like MADS-box protein AGL11 | ||||
Refseq | XP_027921557.1 | 1e-164 | agamous-like MADS-box protein AGL11 | ||||
Swissprot | F6I457 | 1e-137 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A0L9UK22 | 1e-162 | A0A0L9UK22_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3SJK7 | 1e-162 | A0A0S3SJK7_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A1S3VYH0 | 1e-162 | A0A1S3VYH0_VIGRR; agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A4D6M260 | 1e-162 | A0A4D6M260_VIGUN; MADS-box transcription factor | ||||
TrEMBL | V7BUA1 | 1e-162 | V7BUA1_PHAVU; Uncharacterized protein | ||||
STRING | XP_007148609.1 | 1e-163 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF684 | 29 | 102 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.1 | 1e-122 | MIKC_MADS family protein |