PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang0032ss02050.1 | ||||||||
Common Name | LR48_Vigan08g135500 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 214aa MW: 24576.4 Da PI: 8.9187 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 27.4 | 9.2e-09 | 9 | 40 | 2 | 33 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleev 33 ppGfrF Pt+eelv +yL++k+e+++++++ v Vang0032ss02050.1 9 PPGFRFFPTEEELVGFYLRNKLEASRNNAAAV 40 8**********************999777544 PP | |||||||
2 | NAM | 82.2 | 1.1e-25 | 45 | 118 | 55 | 128 |
NAM 55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++w+fFs+ ++++a+g r++r+t+sgyWkatg+ v+s++++++g+kk++vfykg+ap g+kt+W m+eyr+ Vang0032ss02050.1 45 DRQWFFFSPGQEREARGGRPSRTTTSGYWKATGSPGYVYSSDNRVIGVKKSMVFYKGKAPMGRKTKWKMNEYRA 118 689*********************************************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.98E-38 | 5 | 137 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 28.311 | 8 | 139 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.8E-23 | 9 | 117 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 214 aa Download sequence Send to blast |
MPNIMEDHPP GFRFFPTEEE LVGFYLRNKL EASRNNAAAV TAAIDRQWFF FSPGQEREAR 60 GGRPSRTTTS GYWKATGSPG YVYSSDNRVI GVKKSMVFYK GKAPMGRKTK WKMNEYRAIS 120 NPVTPQLRCE FSLYRVYIVS GSFRAFDRRP SEAEGAESRL HQSSSQVSHL LQLSQLSELS 180 QLPEAGDSSS RNWNEEQLQE PSWELEWEHF NWF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-26 | 9 | 119 | 18 | 143 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-26 | 9 | 119 | 18 | 143 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-26 | 9 | 119 | 18 | 143 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-26 | 9 | 119 | 18 | 143 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-26 | 9 | 119 | 21 | 146 | NAC domain-containing protein 19 |
3swm_B | 3e-26 | 9 | 119 | 21 | 146 | NAC domain-containing protein 19 |
3swm_C | 3e-26 | 9 | 119 | 21 | 146 | NAC domain-containing protein 19 |
3swm_D | 3e-26 | 9 | 119 | 21 | 146 | NAC domain-containing protein 19 |
3swp_A | 3e-26 | 9 | 119 | 21 | 146 | NAC domain-containing protein 19 |
3swp_B | 3e-26 | 9 | 119 | 21 | 146 | NAC domain-containing protein 19 |
3swp_C | 3e-26 | 9 | 119 | 21 | 146 | NAC domain-containing protein 19 |
3swp_D | 3e-26 | 9 | 119 | 21 | 146 | NAC domain-containing protein 19 |
4dul_A | 3e-26 | 9 | 119 | 18 | 143 | NAC domain-containing protein 19 |
4dul_B | 3e-26 | 9 | 119 | 18 | 143 | NAC domain-containing protein 19 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang0032ss02050.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015039 | 1e-146 | AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017432785.1 | 1e-140 | PREDICTED: NAC domain-containing protein 90-like | ||||
Swissprot | Q9FMR3 | 7e-63 | NAC90_ARATH; NAC domain-containing protein 90 | ||||
TrEMBL | A0A0L9V6B6 | 1e-139 | A0A0L9V6B6_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3SC53 | 1e-139 | A0A0S3SC53_PHAAN; Uncharacterized protein | ||||
STRING | XP_007132453.1 | 1e-115 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF871 | 34 | 123 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G22380.1 | 1e-59 | NAC domain containing protein 90 |
Publications ? help Back to Top | |||
---|---|---|---|
|