PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678475717
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 183aa    MW: 20410.1 Da    PI: 5.2774
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678475717genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS71.22e-22851831102
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lL+ cA+a+s++ l++ ++l++  ++ +s +g+p+qRl ay++e+L ar   s++++y+al+++e +    ++ l+++++++e++P+lkf++++aN 
  678475717  85 LKQLLIGCAKALSENRLAEFHKLVECCRKGVSISGEPIQRLGAYMLEGLVARTELSGTKIYRALKCNEPE---GQDLLTYMHILYEICPYLKFGYMAANG 181
                689******************************************************************9...99************************* PP

       GRAS 101 aI 102
                aI
  678475717 182 AI 183
                *9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098515.26359183IPR005202Transcription factor GRAS
PfamPF035146.9E-2085183IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
TLHPYETTCG GGLQALLELE HALMGPDYEG EEVASSEDPR LNDSRRPQTP GSTMSNWNQG  60
SHWSNQMDYH ESFRQELPSP SPSNLKQLLI GCAKALSENR LAEFHKLVEC CRKGVSISGE  120
PIQRLGAYML EGLVARTELS GTKIYRALKC NEPEGQDLLT YMHILYEICP YLKFGYMAAN  180
GAI
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678475717
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095306.15e-61scarecrow-like protein 21
RefseqXP_020553937.15e-61scarecrow-like protein 21
SwissprotQ69VG11e-46CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLA0A1X9ITR42e-55A0A1X9ITR4_POPTO; Uncharacterized protein
STRINGPOPTR_0001s44090.19e-56(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.22e-39GRAS family protein
Publications ? help Back to Top
  1. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]