PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678472615 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 119aa MW: 13659.8 Da PI: 11.6796 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 45 | 2.3e-14 | 19 | 73 | 2 | 56 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 +++++ +r+++NReAArrsR+RKk++ + L + +L N L+++l+ + 678472615 19 CDDRKRKRMMSNREAARRSRLRKKQYADDLVNQLHTLRVNNGCLRDQLSVAMRDC 73 68999****************************************9987666655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.1E-13 | 18 | 82 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 7.0E-11 | 19 | 75 | No hit | No description |
PROSITE profile | PS50217 | 10.048 | 20 | 83 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 3.4E-11 | 22 | 73 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 7.88E-12 | 22 | 71 | No hit | No description |
CDD | cd14702 | 6.39E-12 | 23 | 74 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 25 | 40 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MALEDMGNPP LQCRPPVSCD DRKRKRMMSN REAARRSRLR KKQYADDLVN QLHTLRVNNG 60 CLRDQLSVAM RDCRTAQLQS RQLLSDSIRL LHRLSTLRLF LHRTCAGPGQ ASNGTGFLR |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 34 | 40 | RRSRLRK |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678472615 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2820 | 22 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G18160.1 | 2e-12 | basic leucine-zipper 2 |