PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678467906 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 212aa MW: 23583.6 Da PI: 10.6026 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.8 | 1.9e-16 | 24 | 69 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ed +l+++v+++G+++W++Ia+ + gR++k+c++rw + 678467906 24 RGHWRPHEDAKLKEVVAKFGPRNWNLIAENLV-GRSGKSCRLRWCNQ 69 899*****************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 49.5 | 9.6e-16 | 76 | 119 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++T+ E+e+l+ a +G++ W+tIar ++ gRt++ +k++w+ 678467906 76 RRAFTAAEEERLLAAQGVYGNK-WATIARLFP-GRTDNAVKNHWHV 119 678*******************.*********.***********85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.152 | 19 | 70 | IPR017930 | Myb domain |
SMART | SM00717 | 2.8E-14 | 23 | 72 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.35E-27 | 23 | 117 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 9.9E-16 | 24 | 69 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.5E-25 | 25 | 77 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.44E-13 | 27 | 68 | No hit | No description |
PROSITE profile | PS51294 | 23.811 | 71 | 125 | IPR017930 | Myb domain |
SMART | SM00717 | 4.4E-12 | 75 | 123 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.8E-12 | 76 | 118 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.38E-9 | 78 | 118 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.9E-18 | 78 | 123 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 212 aa Download sequence Send to blast |
MTAKVAEEEE EPPPHIGGGE SAARGHWRPH EDAKLKEVVA KFGPRNWNLI AENLVGRSGK 60 SCRLRWCNQL DPRINRRAFT AAEEERLLAA QGVYGNKWAT IARLFPGRTD NAVKNHWHVI 120 QARKHRDSKN RRATSFTRSQ SSTISSLKLF SVSAFNSIHL HKQTTMAMPA EDSSSQVSAL 180 ESITNIHSNT NVRVCGKEKS IGFIDFLGVG AT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-30 | 18 | 124 | 1 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269|PubMed:20305120}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678467906 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by wounding. {ECO:0000269|PubMed:20305120}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006339216.1 | 1e-64 | PREDICTED: myb-related protein B | ||||
Refseq | XP_012839515.1 | 7e-65 | PREDICTED: transcriptional activator Myb-like | ||||
Swissprot | Q5NBM8 | 9e-59 | CSA_ORYSJ; Transcription factor CSA | ||||
TrEMBL | A0A2G9GMH5 | 1e-66 | A0A2G9GMH5_9LAMI; Transcription factor, Myb superfamily | ||||
TrEMBL | A0A4D8YT84 | 1e-67 | A0A4D8YT84_SALSN; Myb proto-oncogene protein, plant | ||||
STRING | PGSC0003DMT400072258 | 4e-64 | (Solanum tuberosum) | ||||
STRING | Migut.J01602.1.p | 3e-64 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1784 | 24 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69560.1 | 8e-60 | myb domain protein 105 |