PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678467906
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MYB
Protein Properties Length: 212aa    MW: 23583.6 Da    PI: 10.6026
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678467906genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-162469147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed +l+++v+++G+++W++Ia+ +  gR++k+c++rw + 
        678467906 24 RGHWRPHEDAKLKEVVAKFGPRNWNLIAENLV-GRSGKSCRLRWCNQ 69
                     899*****************************.***********985 PP

2Myb_DNA-binding49.59.6e-1676119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+ E+e+l+ a   +G++ W+tIar ++ gRt++ +k++w+ 
        678467906  76 RRAFTAAEEERLLAAQGVYGNK-WATIARLFP-GRTDNAVKNHWHV 119
                      678*******************.*********.***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.1521970IPR017930Myb domain
SMARTSM007172.8E-142372IPR001005SANT/Myb domain
SuperFamilySSF466891.35E-2723117IPR009057Homeodomain-like
PfamPF002499.9E-162469IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-252577IPR009057Homeodomain-like
CDDcd001672.44E-132768No hitNo description
PROSITE profilePS5129423.81171125IPR017930Myb domain
SMARTSM007174.4E-1275123IPR001005SANT/Myb domain
PfamPF002495.8E-1276118IPR001005SANT/Myb domain
CDDcd001671.38E-978118No hitNo description
Gene3DG3DSA:1.10.10.601.9E-1878123IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MTAKVAEEEE EPPPHIGGGE SAARGHWRPH EDAKLKEVVA KFGPRNWNLI AENLVGRSGK  60
SCRLRWCNQL DPRINRRAFT AAEEERLLAA QGVYGNKWAT IARLFPGRTD NAVKNHWHVI  120
QARKHRDSKN RRATSFTRSQ SSTISSLKLF SVSAFNSIHL HKQTTMAMPA EDSSSQVSAL  180
ESITNIHSNT NVRVCGKEKS IGFIDFLGVG AT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30181241107B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269|PubMed:20305120}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678467906
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding. {ECO:0000269|PubMed:20305120}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006339216.11e-64PREDICTED: myb-related protein B
RefseqXP_012839515.17e-65PREDICTED: transcriptional activator Myb-like
SwissprotQ5NBM89e-59CSA_ORYSJ; Transcription factor CSA
TrEMBLA0A2G9GMH51e-66A0A2G9GMH5_9LAMI; Transcription factor, Myb superfamily
TrEMBLA0A4D8YT841e-67A0A4D8YT84_SALSN; Myb proto-oncogene protein, plant
STRINGPGSC0003DMT4000722584e-64(Solanum tuberosum)
STRINGMigut.J01602.1.p3e-64(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.18e-60myb domain protein 105
Publications ? help Back to Top
  1. Leonard LM,Follette VM
    Sexual functioning in women reporting a history of child sexual abuse: review of the empirical literature and clinical implications.
    Annu Rev Sex Res, 2002. 13: p. 346-88
    [PMID:12836736]
  2. Wang L,Li X,Chen Z
    Sulfated modification of the polysaccharides obtained from defatted rice bran and their antitumor activities.
    Int. J. Biol. Macromol., 2009. 44(2): p. 211-4
    [PMID:19135473]
  3. Wang L,Huang H,Wei Y,Li X,Chen Z
    Characterization and anti-tumor activities of sulfated polysaccharide SRBPS2a obtained from defatted rice bran.
    Int. J. Biol. Macromol., 2009. 45(4): p. 427-31
    [PMID:19549538]
  4. Zhang H, et al.
    Carbon starved anther encodes a MYB domain protein that regulates sugar partitioning required for rice pollen development.
    Plant Cell, 2010. 22(3): p. 672-89
    [PMID:20305120]
  5. Zhang H, et al.
    Mutation in CSA creates a new photoperiod-sensitive genic male sterile line applicable for hybrid rice seed production.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(1): p. 76-81
    [PMID:23256151]
  6. Zhu X, et al.
    Brassinosteroids promote development of rice pollen grains and seeds by triggering expression of Carbon Starved Anther, a MYB domain protein.
    Plant J., 2015. 82(4): p. 570-81
    [PMID:25754973]
  7. Li X, et al.
    Metabolic and transcriptomic signatures of rice floral organs reveal sugar starvation as a factor in reproductive failure under heat and drought stress.
    Plant Cell Environ., 2015. 38(10): p. 2171-92
    [PMID:25828772]
  8. Shaar-Moshe L,Hübner S,Peleg Z
    Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach.
    BMC Plant Biol., 2015. 15: p. 111
    [PMID:25935420]