PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678464754
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 530aa    MW: 59479.9 Da    PI: 5.46
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678464754genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS375.66.3e-1151485302374
       GRAS   2 velLlecAeavssgdle..........laqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                +elL++cAe+v + d             +++l++ ++e++s +gdp+qRl ay++e+++a+l++++  lyk+l++++  + +sse ++++++ +e++P++
  678464754 148 KELLITCAEVVGEADSIsssrrqswsaVVEELMKLIEERVSVSGDPLQRLGAYMLEGIRAKLLQTGFILYKKLRCNQPVNPSSSELMSYMHVIYEICPYF 247
                688999999886644321222334444678888999999***************************************9999****************** PP

       GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                kf+++     I ea+e+e+ +HiiDf+i qG QW++++q+ + Rp+gpp++ iTgv++p+s+  +   le +g+rLa +Ae++gvpfef+  +a   +++
  678464754 248 KFAYVSSSVIINEAMENESSIHIIDFQIAQGSQWISFIQSVSLRPGGPPTVHITGVDDPQSTyaRGGGLEIVGQRLAIVAEKCGVPFEFHN-AAICGTEV 346
                ************************************************************9999999************************.8999**** PP

       GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErel 289
                +le+L++++gEalaVn+ + lh+++de v++e++rd++L+lvk+l+Pk+v+++eqe+++n+++F+ rf+e+l+yy+a+f+s++a  +re++ ri+ E+++
  678464754 347 QLENLHIRNGEALAVNFPYVLHHMPDEGVTTENHRDRLLRLVKHLRPKIVTIIEQESNTNTSPFVPRFCETLDYYTAMFESIDARRSREDRVRISTEEHC 446
                **************************************************************************************************** PP

       GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                +++++vn++aceg er+erhe ++kWr+rl++a F++v+ls+ +   ++ llr ++   y+v ee+g l+lgWk+r++ ++SaWr
  678464754 447 VAKDVVNIIACEGVEREERHELFGKWRSRLGMAQFSQVRLSSAVSYAVRDLLRAYS-PHYKVWEENGGLYLGWKNRAMSTCSAWR 530
                *******************************************************9.55*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.66121511IPR005202Transcription factor GRAS
PfamPF035142.2E-112148530IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MLMSQDTEPP SSFPSFCSQP MPSRTQSYGF SNAATTRSGS QGSGVSYAEH YPTLESVHEI  60
SVFTHSSPSI GSNTSSWSPF SPHGSHYSLV SEDQLSFYNA VPDSGWLVGS TIEDEFNMMQ  120
SLQGPDSDSD ESPRYSRVLE MAQEKDLKEL LITCAEVVGE ADSISSSRRQ SWSAVVEELM  180
KLIEERVSVS GDPLQRLGAY MLEGIRAKLL QTGFILYKKL RCNQPVNPSS SELMSYMHVI  240
YEICPYFKFA YVSSSVIINE AMENESSIHI IDFQIAQGSQ WISFIQSVSL RPGGPPTVHI  300
TGVDDPQSTY ARGGGLEIVG QRLAIVAEKC GVPFEFHNAA ICGTEVQLEN LHIRNGEALA  360
VNFPYVLHHM PDEGVTTENH RDRLLRLVKH LRPKIVTIIE QESNTNTSPF VPRFCETLDY  420
YTAMFESIDA RRSREDRVRI STEEHCVAKD VVNIIACEGV EREERHELFG KWRSRLGMAQ  480
FSQVRLSSAV SYAVRDLLRA YSPHYKVWEE NGGLYLGWKN RAMSTCSAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A6e-5217652935378Protein SCARECROW
5b3h_A6e-5217652934377Protein SCARECROW
5b3h_D6e-5217652934377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678464754
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095941.10.0scarecrow-like protein 13
SwissprotQ8H1251e-169SCL5_ARATH; Scarecrow-like protein 5
TrEMBLA0A022QK740.0A0A022QK74_ERYGU; Uncharacterized protein
STRINGMigut.M01421.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.11e-172scarecrow-like 5
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]