PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678464228
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 558aa    MW: 63419.6 Da    PI: 5.1966
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678464228genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS368.21.1e-1121805552374
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                ++lL ++A+avs  ++ +a++lL  ++ ++sp+gd ++Rla+yf++AL ar+ +++s ly a ++s +++++ ++ l+ ++++++++P+ ++s+++aN++
  678464228 180 KTLLSQAAKAVSVLNNGAARELLMGIRRHSSPYGDHTERLAHYFANALDARIEGTGSMLYTAAASSLSRSSQPAQILKCYQAYFQACPFQRLSNIVANKT 279
                57999*********************************************************************************************** PP

       GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpg 199
                I   + +++++HiiDf+i++G+QWp+L+q ++ +p+gpp l+iTg++ p++g   + ++e++g+ L +++++++vpfe+++ +ak++++++le+L ++++
  678464228 280 IALYTREAQKIHIIDFGIMYGFQWPCLIQGISLKPGGPPLLKITGIDLPQAGlkPAARVERVGRWLMSYCKRFDVPFEYHP-IAKKWKEIKLEDLGIEED 378
                ***************************************************9999**************************.7***************** PP

       GRAS 200 EalaVnlvlqlhrlldesvsl..eserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                E+++Vn+v+q++++l+es+sl  es+rd+vLkl++++ P+++v+  ++a+h+ + F +rf eal++ys lfd+lea++pre++er+++Er +lg ei+nv
  678464228 379 EVVVVNSVYQMKHVLEESMSLdlESPRDSVLKLIREIYPTIFVHGISNANHGVPLFTTRFGEALNHYSCLFDMLEATMPREDNERQVYERDILGSEIMNV 478
                ****************987751167*************************************************************************** PP

       GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                v+ceg+er+er e ++kW+ r ++aGF+++pl++++ ++ak+ +r  +   + vee+ +++++gWk+r ++++S+W+
  678464228 479 VTCEGSERVERPEGYKKWQVRDNRAGFEQLPLDKQILQEAKTKVRLWYHPDFLVEEDGKWMLQGWKGRVVYALSFWK 555
                ************************************************999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.961153535IPR005202Transcription factor GRAS
PfamPF035143.8E-110180555IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MVACDYFNGV FEYIEKILME EDDDADNLGA FSSCIEKTFY DLLDSQAQDE AAGTGRIDGD  60
GDSGQGHPFP GGESQGKGRR RRDDEENEDD DDQERRRKQI AAGDDDDECE PTDKYDKTLL  120
CQKMNPCFYE TSTACTGNNQ DSSEDENVSR KYIKPPELKR GRPKKGSKKQ SGVKEIIDFK  180
TLLSQAAKAV SVLNNGAARE LLMGIRRHSS PYGDHTERLA HYFANALDAR IEGTGSMLYT  240
AAASSLSRSS QPAQILKCYQ AYFQACPFQR LSNIVANKTI ALYTREAQKI HIIDFGIMYG  300
FQWPCLIQGI SLKPGGPPLL KITGIDLPQA GLKPAARVER VGRWLMSYCK RFDVPFEYHP  360
IAKKWKEIKL EDLGIEEDEV VVVNSVYQMK HVLEESMSLD LESPRDSVLK LIREIYPTIF  420
VHGISNANHG VPLFTTRFGE ALNHYSCLFD MLEATMPRED NERQVYERDI LGSEIMNVVT  480
CEGSERVERP EGYKKWQVRD NRAGFEQLPL DKQILQEAKT KVRLWYHPDF LVEEDGKWML  540
QGWKGRVVYA LSFWKPTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-521795555375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17997RRRDDEENEDDDDQERRRK
Cis-element ? help Back to Top
SourceLink
PlantRegMap678464228
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022874865.10.0scarecrow-like protein 14
TrEMBLA0A2G9I6C20.0A0A2G9I6C2_9LAMI; Uncharacterized protein
STRINGMigut.D02077.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-146SCARECROW-like 14