PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678463650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 198aa    MW: 22885.5 Da    PI: 10.4466
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678463650genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS78.41.3e-2491192222323
       GRAS 222 serdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                  +++ L+l++++ P+++++   +  +n++ F++rf eal  ys+lfd+++a++ re+e+r  +E++l+++++ +++ ceg++r+e  +t+++W+   ++
  678463650  91 RLQNAALRLIRKIDPDIFIFRVVNGTYNTPHFVARFREALFQYSSLFDMFDATMCREHENRLLLEAQLFRKKALSIIVCEGSQRVEHPKTYKQWQVGNRK 190
                345699****************************************************************************************987766 PP

       GRAS 322 aG 323
                aG
  678463650 191 AG 192
                66 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098514.7071198IPR005202Transcription factor GRAS
PfamPF035144.5E-2291192IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MAFNGLVSSV LYPHGLMDLG NFMSQGLISC NHDSDQLLGW LWPTLGTVRD SVFPLSTVQQ  60
NRNGKPLFYR LSESKISRLK RVNCSLNSLY RLQNAALRLI RKIDPDIFIF RVVNGTYNTP  120
HFVARFREAL FQYSSLFDMF DATMCREHEN RLLLEAQLFR KKALSIIVCE GSQRVEHPKT  180
YKQWQVGNRK AGNILGRR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678463650
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089500.14e-39scarecrow-like protein 30
SwissprotO809338e-32SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A1S4BI927e-36A0A1S4BI92_TOBAC; scarecrow-like protein 14
STRINGGLYMA11G14670.13e-36(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.13e-34GRAS family protein