PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678462075
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MYB
Protein Properties Length: 174aa    MW: 19503.3 Da    PI: 8.8455
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678462075genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.61.6e-0978114138
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlk 38 
                      rg W + Ed  l ++v+++G+ +W++I++ +  gR+++
        678462075  78 RGHWRPAEDSMLRELVALYGPQNWNLISQGLE-GRSGN 114
                      899*****************************.***98 PP

2Myb_DNA-binding41.92.2e-13134170947
                      HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   9 dellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +++l  a++++G++ W+ Iar ++ gRt++ +k++w+ +
        678462075 134 EDRLMAAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHVV 170
                      689***********.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.80273125IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-1074114IPR009057Homeodomain-like
SMARTSM007172.8E-477126IPR001005SANT/Myb domain
PfamPF002498.8E-978114IPR001005SANT/Myb domain
SuperFamilySSF466892.61E-1778171IPR009057Homeodomain-like
CDDcd001671.40E-781115No hitNo description
PfamPF002497.3E-10134169IPR001005SANT/Myb domain
CDDcd001677.48E-8134171No hitNo description
SMARTSM007170.0013134173IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-13134169IPR009057Homeodomain-like
PROSITE profilePS5129415.03134174IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MATPPAWSPN SFFPCLLIEM AFLSKGFPGK KDTETASSSE LPNCVFPRLH NRAFDLNTAA  60
SNDGECEESQ AHSKACARGH WRPAEDSMLR ELVALYGPQN WNLISQGLEG RSGNMKSIHY  120
LVRKLSLLCN GSCEDRLMAA HRLYGNKWAM IARLFPGRTD NAVKNHWHVV MARK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-19771746107B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning. Functions in both lateral organ separation and axillary meristem formation. {ECO:0000269|PubMed:19542355}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678462075
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017222090.12e-46PREDICTED: transcription factor MYB80
RefseqXP_027152539.11e-46transcription factor MYB105-like
SwissprotQ9SEZ41e-40MY105_ARATH; Transcription factor MYB105
TrEMBLA0A175YP686e-46A0A175YP68_DAUCS; Uncharacterized protein
STRINGXP_006483696.16e-44(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.16e-43myb domain protein 105
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]