![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678462075 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 174aa MW: 19503.3 Da PI: 8.8455 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 29.6 | 1.6e-09 | 78 | 114 | 1 | 38 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlk 38 rg W + Ed l ++v+++G+ +W++I++ + gR+++ 678462075 78 RGHWRPAEDSMLRELVALYGPQNWNLISQGLE-GRSGN 114 899*****************************.***98 PP | |||||||
2 | Myb_DNA-binding | 41.9 | 2.2e-13 | 134 | 170 | 9 | 47 |
HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 9 dellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +++l a++++G++ W+ Iar ++ gRt++ +k++w+ + 678462075 134 EDRLMAAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHVV 170 689***********.*********.***********976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 11.802 | 73 | 125 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.1E-10 | 74 | 114 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.8E-4 | 77 | 126 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.8E-9 | 78 | 114 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.61E-17 | 78 | 171 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.40E-7 | 81 | 115 | No hit | No description |
Pfam | PF00249 | 7.3E-10 | 134 | 169 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.48E-8 | 134 | 171 | No hit | No description |
SMART | SM00717 | 0.0013 | 134 | 173 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-13 | 134 | 169 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.03 | 134 | 174 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MATPPAWSPN SFFPCLLIEM AFLSKGFPGK KDTETASSSE LPNCVFPRLH NRAFDLNTAA 60 SNDGECEESQ AHSKACARGH WRPAEDSMLR ELVALYGPQN WNLISQGLEG RSGNMKSIHY 120 LVRKLSLLCN GSCEDRLMAA HRLYGNKWAM IARLFPGRTD NAVKNHWHVV MARK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-19 | 77 | 174 | 6 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning. Functions in both lateral organ separation and axillary meristem formation. {ECO:0000269|PubMed:19542355}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678462075 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017222090.1 | 2e-46 | PREDICTED: transcription factor MYB80 | ||||
Refseq | XP_027152539.1 | 1e-46 | transcription factor MYB105-like | ||||
Swissprot | Q9SEZ4 | 1e-40 | MY105_ARATH; Transcription factor MYB105 | ||||
TrEMBL | A0A175YP68 | 6e-46 | A0A175YP68_DAUCS; Uncharacterized protein | ||||
STRING | XP_006483696.1 | 6e-44 | (Citrus sinensis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1784 | 24 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69560.1 | 6e-43 | myb domain protein 105 |
Publications ? help Back to Top | |||
---|---|---|---|
|