PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678461446 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 185aa MW: 21082.1 Da PI: 6.7188 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 172.8 | 3.6e-54 | 24 | 118 | 1 | 95 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 vreqdrf+Pianv+rim+k+lP +akis+daket+qecvse+isf+tsea+d+cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yre++g 678461446 24 VREQDRFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITSEANDRCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYREFDG 118 69******************************************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.9E-51 | 19 | 127 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.97E-39 | 27 | 127 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.8E-26 | 30 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.4E-17 | 58 | 76 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 61 | 77 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.4E-17 | 77 | 95 | No hit | No description |
PRINTS | PR00615 | 1.4E-17 | 96 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0033613 | Molecular Function | activating transcription factor binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 185 aa Download sequence Send to blast |
MHSPEIARGL PALPLLPQNS ECIVREQDRF MPIANVIRIM RKILPPHAKI SDDAKETIQE 60 CVSEYISFIT SEANDRCQRE QRKTITAEDV LWAMSKLGFD DYIEPLTLYL HRYREFDGGE 120 RGSVKRMVEH SGGMGFPLFH NTPPFHSGTH HGYFPTPPAM NLFKDAGPGM EGPPGFMDRF 180 PPRKE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 1e-60 | 20 | 115 | 2 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678461446 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022018583.1 | 2e-76 | nuclear transcription factor Y subunit B-6-like | ||||
Swissprot | Q84W66 | 1e-62 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | S8DRX0 | 3e-80 | S8DRX0_9LAMI; Leafy cotyledon 1-like protein (Fragment) | ||||
STRING | XP_009781818.1 | 7e-73 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 3e-65 | nuclear factor Y, subunit B6 |