PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678461139
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 786aa    MW: 84830.5 Da    PI: 5.9045
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678461139genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS327.13.4e-1004237843374
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                ++L+++Ae +++g+l la+ +Larl+++ sp g+p++R+a+y +eAL+  l+ s+++l+    +++ s+ n ++++ a++ fse+sP+++f++lt NqaI
  678461139 423 DQLYKAAELLQTGNLVLAHGILARLNHQLSPIGKPFHRAAFYCKEALQLLLHCSSNNLSLPY-STPRSPLNLVSKIGAYRSFSEISPLVQFANLTSNQAI 521
                68**************************************************9888877544.444455789**************************** PP

       GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle.leeLrvkpgEa 201
                 ea +g+ervHiiDfdi++G+QW++Llq+++++++ +ps+ iT+++sp ++++ el+ t+e+L +fA+e++++f+f+v+  ++l++ + l+  +   +Ea
  678461139 522 IEASQGSERVHIIDFDIGYGGQWASLLQEFSTQSGCAPSVMITALVSPMTHDQVELSLTRENLIQFAREINISFKFQVVSIDSLSSASwLRPAHSADNEA 621
                ******************************************************************************9788777764144456666*** PP

       GRAS 202 laVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvace 301
                +aVnl  +   ++  + sl+s    vL++vk+lsP++vv v+  +d+++ +F + +++al+ ys+l++sl+a + +  ++ +k+Er+ll++ i++++  +
  678461139 622 IAVNLPASCLATY--QFSLPS----VLRFVKQLSPRIVVAVDWGCDRTDLPFPNTVIHALQSYSSLMESLDAAANAPLDAIQKIERFLLQPGIEKLILGR 715
                *******998888..677777....************************************************99999*******************987 PP

       GRAS 302 gaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +     e++++Wr++l ++GF+pv++s+++ +qa+++++++++ g++ve+++ slvl+W++++L+s+SaWr
  678461139 716 FCS----PEKMQHWRSMLLSVGFSPVSFSNFTDAQAECIIKRTPVAGFQVEKRQSSLVLCWQRKELISTSAWR 784
                776....9****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.047395764IPR005202Transcription factor GRAS
PfamPF035141.2E-97423784IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 786 aa     Download sequence    Send to blast
MKGMPLAFDF EGKGVLDLEL IVKNQGFFSS GCADFYQGSC FFNNCFVEPT SVLDSVTTPS  60
QLTSSSTLSS SLGGGGGGGG GGAAFTDSAA LALASDANPS SKWQQQDSTT ATSTNAGGSE  120
PGLLPIPTSL EIGGAVGGSR EHPQRFEMDD WNSVLSESAA VSPSQEQAIL RWFMGDVEDT  180
GLGNLNKVFQ TGDGGGGASV MPSAEYGFSG GYGSVDQGFS GNHLGGGLVP ALPVFSSNDN  240
RFSTSKLGIL PSSAPSSLKL SSNSHGLVHP SPVFSSSGSI AFQNQTPFDS PAETKPQTLN  300
SGLQMNQNYQ NTSFVPLSYT QLQEQGSVYL PPQAKKRNFL GMDEDGIRPA GEISKGPFID  360
TGQQEHLMGR FLPFSLQQQV PHPLQWPPHH LPQRPITEEE KPKFVAGKDL ENCHQQQQQA  420
TADQLYKAAE LLQTGNLVLA HGILARLNHQ LSPIGKPFHR AAFYCKEALQ LLLHCSSNNL  480
SLPYSTPRSP LNLVSKIGAY RSFSEISPLV QFANLTSNQA IIEASQGSER VHIIDFDIGY  540
GGQWASLLQE FSTQSGCAPS VMITALVSPM THDQVELSLT RENLIQFARE INISFKFQVV  600
SIDSLSSASW LRPAHSADNE AIAVNLPASC LATYQFSLPS VLRFVKQLSP RIVVAVDWGC  660
DRTDLPFPNT VIHALQSYSS LMESLDAAAN APLDAIQKIE RFLLQPGIEK LILGRFCSPE  720
KMQHWRSMLL SVGFSPVSFS NFTDAQAECI IKRTPVAGFQ VEKRQSSLVL CWQRKELIST  780
SAWRPH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3343978421375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678461139
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090295.10.0scarecrow-like protein 6
TrEMBLA0A2G9GWL50.0A0A2G9GWL5_9LAMI; Uncharacterized protein
STRINGPGSC0003DMT4000667990.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-125GRAS family protein