PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678460771
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 566aa    MW: 62472.9 Da    PI: 5.3521
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678460771genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS403.71.8e-1232045611374
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                lv++L++cAeav++++l+la+al++ +  la +++ +m+++a +f eAL +r+ +         +p++ +  + s + + ++ f++++P+lkf+h+taNq
  678460771 204 LVHTLMACAEAVQQEKLKLAEALVNSIGVLAVSQAGAMRKVALCFQEALGRRIRK---------APTNLP--DFSINYKLQNHFYDACPYLKFAHFTANQ 292
                689***************************************************9.........333333..35556667777***************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpg 199
                aI ea++g+++vH+iDf+i+qG+QWp LlqaLa+ p+g+p ++R+Tg+g+pe  +++ l+++g +L+++A+e++v f+++ +v+k+l+dl+ ++L +++g
  678460771 293 AIFEAFAGKKHVHVIDFSINQGIQWPLLLQALATSPRGAPqTFRLTGIGPPE--QSDDLQQVGLNLSHLAKEMNVAFDYRKIVVKSLADLDASMLCIREG 390
                **********************************99777769********88..********************************************** PP

       GRAS 200 EalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvva 299
                E++aVn+++ lh++l++++++++    vL+lv++l+P++++vveqea+hn+  F +rf+ al+yysalfdsle++ ++ s++++ +++ +lg++i+nvva
  678460771 391 ETVAVNSIFDLHQMLARPGAIDK----VLHLVRELRPQIFTVVEQEASHNDDFFYDRFTGALHYYSALFDSLESGGSSISDKDKAMSELYLGQQICNVVA 486
                ***************99999988....************************************************99999******************** PP

       GRAS 300 cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                cega+r erhetl +W +r+ +aGF pv+l++++ kqa ++l+  +++gy+v+e +g+l lgW++ pL+++SaWr
  678460771 487 CEGADRLERHETLVQWMNRFVSAGFDPVHLGSNVHKQAMMILAYSGGNGYTVDECNGCLKLGWQNLPLIATSAWR 561
                **************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011294.0E-2233106No hitNo description
PfamPF120411.4E-233396IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098560.34178541IPR005202Transcription factor GRAS
PfamPF035146.4E-121204561IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MKREYLGEEN CSSSWGNCSS DKAKMWGGVE EEDELFGLLG YTVKPSEMAE VAEKIHQIEM  60
AMWNASEDGF SEFAADTIHY NPSDISSWLE SMRSGVSALP EFDSSADSFL KSPKTENGSC  120
RVKISDRMAI DLDFGSDLIA IPGKAIYPVD HSLEISHQPP SKKVKTSPPP PWPPRMSSSV  180
GDSGGALAPP RSLLVDSEEN GIRLVHTLMA CAEAVQQEKL KLAEALVNSI GVLAVSQAGA  240
MRKVALCFQE ALGRRIRKAP TNLPDFSINY KLQNHFYDAC PYLKFAHFTA NQAIFEAFAG  300
KKHVHVIDFS INQGIQWPLL LQALATSPRG APQTFRLTGI GPPEQSDDLQ QVGLNLSHLA  360
KEMNVAFDYR KIVVKSLADL DASMLCIREG ETVAVNSIFD LHQMLARPGA IDKVLHLVRE  420
LRPQIFTVVE QEASHNDDFF YDRFTGALHY YSALFDSLES GGSSISDKDK AMSELYLGQQ  480
ICNVVACEGA DRLERHETLV QWMNRFVSAG FDPVHLGSNV HKQAMMILAY SGGNGYTVDE  540
CNGCLKLGWQ NLPLIATSAW RMPDSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-5719856013378Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678460771
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070609.10.0DELLA protein GAI1
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A2G9HQV20.0A0A2G9HQV2_9LAMI; Uncharacterized protein
STRINGMigut.E00445.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein