PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678460504 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 202aa MW: 22733.8 Da PI: 9.9631 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 60 | 3.7e-19 | 79 | 133 | 2 | 56 |
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 rk+ ++t++q+ Le+ F+ + +++ +e++ LA+kl+L+ rqV vWFqNrRa+ k 678460504 79 RKKLRLTRDQTSLLEDSFRHQTTLNMAEKQALAEKLKLKPRQVEVWFQNRRARTK 133 678899***********************************************98 PP | |||||||
2 | HD-ZIP_I/II | 111.2 | 7e-36 | 79 | 168 | 1 | 90 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 +kk+rl+++q +lLE+sF+++++L+ +K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e L++++++l een+rL++e ++L + 678460504 79 RKKLRLTRDQTSLLEDSFRHQTTLNMAEKQALAEKLKLKPRQVEVWFQNRRARTKLKQTEVDCELLRKNCERLLEENRRLKEELSKLGKV 168 69***********************************************************************************99865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.5E-18 | 52 | 136 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.84E-18 | 67 | 136 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 16.698 | 75 | 135 | IPR001356 | Homeobox domain |
SMART | SM00389 | 1.5E-14 | 77 | 139 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 2.5E-16 | 79 | 133 | IPR001356 | Homeobox domain |
CDD | cd00086 | 7.75E-15 | 79 | 136 | No hit | No description |
PROSITE pattern | PS00027 | 0 | 110 | 133 | IPR017970 | Homeobox, conserved site |
Pfam | PF02183 | 4.1E-8 | 135 | 167 | IPR003106 | Leucine zipper, homeobox-associated |
SMART | SM00340 | 8.3E-9 | 135 | 176 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MEEDDEAPLG LGLRLGIGDF TAAGKPRSGK KRVFLVDLPF PVHKSSSDGT TSADDSSLKE 60 EVDEGGGGCS RSYSKDFGRK KLRLTRDQTS LLEDSFRHQT TLNMAEKQAL AEKLKLKPRQ 120 VEVWFQNRRA RTKLKQTEVD CELLRKNCER LLEENRRLKE ELSKLGKVLP EFLRSSTVPE 180 KTGKHQHRGG GVKPAVVPEH QP |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 127 | 135 | RRARTKLKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the negative regulation of cell elongation and specific cell proliferation processes such as lateral root formation and secondary growth of the vascular system. Acts as mediator of the red/far-red light effects on leaf cell expansion in the shading response. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. Negatively regulates its own expression. {ECO:0000269|PubMed:10477292, ECO:0000269|PubMed:11260495, ECO:0000269|PubMed:8449400}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678460504 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Rapidly and strongly induced by lowering the ratio of red to far-red light. {ECO:0000269|PubMed:8106086}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012837577.1 | 3e-50 | PREDICTED: homeobox-leucine zipper protein HOX17-like | ||||
Swissprot | Q05466 | 1e-35 | HAT4_ARATH; Homeobox-leucine zipper protein HAT4 | ||||
TrEMBL | A0A022RC48 | 7e-49 | A0A022RC48_ERYGU; Uncharacterized protein | ||||
TrEMBL | S8DMC7 | 3e-49 | S8DMC7_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Migut.J01509.1.p | 2e-42 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA290 | 24 | 186 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G06710.1 | 1e-19 | homeobox from Arabidopsis thaliana |