PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678460368 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | CAMTA | ||||||||
Protein Properties | Length: 105aa MW: 12511.8 Da PI: 11.2281 | ||||||||
Description | CAMTA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CG-1 | 75.9 | 5.4e-24 | 8 | 53 | 36 | 81 |
CG-1 36 sgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevl 81 gsl+L++rk+vryfr+DG++w+kkkdgktv+E+he+LKv+ ++ l 678460368 8 GGSLFLFDRKVVRYFRNDGHNWRKKKDGKTVKEAHERLKVDIIQHL 53 69***************************************99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51437 | 29.596 | 1 | 98 | IPR005559 | CG-1 DNA-binding domain |
SMART | SM01076 | 8.1E-6 | 2 | 70 | IPR005559 | CG-1 DNA-binding domain |
Pfam | PF03859 | 8.8E-18 | 8 | 53 | IPR005559 | CG-1 DNA-binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
MIYVHLLGGS LFLFDRKVVR YFRNDGHNWR KKKDGKTVKE AHERLKVDII QHLLRDRTAR 60 HVYRILTRMP SFRLEVWMFC TATMLMERSR KIFAGVATGC LKSTN |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678460368 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012437208.1 | 5e-20 | PREDICTED: calmodulin-binding transcription activator 3 isoform X2 | ||||
Refseq | XP_012437209.1 | 5e-20 | PREDICTED: calmodulin-binding transcription activator 3 isoform X2 | ||||
Refseq | XP_012437210.1 | 5e-20 | PREDICTED: calmodulin-binding transcription activator 3 isoform X2 | ||||
Refseq | XP_012437211.1 | 5e-20 | PREDICTED: calmodulin-binding transcription activator 3 isoform X2 | ||||
Refseq | XP_016738097.1 | 5e-20 | PREDICTED: calmodulin-binding transcription activator 3-like isoform X2 | ||||
Refseq | XP_016738099.1 | 5e-20 | PREDICTED: calmodulin-binding transcription activator 3-like isoform X2 | ||||
Refseq | XP_016738100.1 | 5e-20 | PREDICTED: calmodulin-binding transcription activator 3-like isoform X2 | ||||
TrEMBL | A0A438KPN7 | 5e-26 | A0A438KPN7_VITVI; Calmodulin-binding transcription activator 3 | ||||
STRING | XP_002519355.1 | 2e-24 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3932 | 20 | 37 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64220.2 | 7e-22 | Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains |