PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678460364 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 244aa MW: 26957.6 Da PI: 6.5563 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 84.3 | 7.5e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 kri+n s rqvtfskRr+g++KKA+EL vLCdaev +iifsstgkl+eyss 678460364 9 KRIDNLSARQVTFSKRRKGLIKKANELAVLCDAEVGLIIFSSTGKLFEYSS 59 79***********************************************96 PP | |||||||
2 | K-box | 51 | 6.1e-18 | 101 | 172 | 28 | 99 |
K-box 28 ienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 + + r++R++ GedL+ Ls+ eLq++e+ L +l+++ +kKne +++ +elq+k +l +en+ L +++e 678460364 101 VIERTRQLRRMRGEDLQGLSIDELQSMEKSLGAGLNRVSAKKNEKIKKRADELQQKIMQLADENELLAREVE 172 44445889***********************************************************99986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.4E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.899 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 9.87E-39 | 2 | 70 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.27E-31 | 3 | 75 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.5E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.5E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.5E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.5E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.468 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.6E-14 | 94 | 171 | IPR002487 | Transcription factor, K-box |
CDD | cd14686 | 5.54E-4 | 136 | 176 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 5.3E-5 | 144 | 175 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MAREKIKIKR IDNLSARQVT FSKRRKGLIK KANELAVLCD AEVGLIIFSS TGKLFEYSSS 60 SMDDILERYR LHCKNASNLV QPSLDLELVV GSDLPTLSKE VIERTRQLRR MRGEDLQGLS 120 IDELQSMEKS LGAGLNRVSA KKNEKIKKRA DELQQKIMQL ADENELLARE VEYLSNRSHP 180 DGPPSSETTG FDDVPSSEST TSITDPILSK SSSDASLTLG LGCNVPEPDR TTSSKGSLLS 240 ETLS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 5e-22 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 5e-22 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 5e-22 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 5e-22 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678460364 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020554864.1 | 2e-79 | MADS-box protein SVP | ||||
Swissprot | Q9FUY6 | 1e-69 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
Swissprot | Q9FVC1 | 1e-69 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A068U051 | 1e-77 | A0A068U051_COFCA; Uncharacterized protein | ||||
STRING | GLYMA02G04710.1 | 1e-74 | (Glycine max) | ||||
STRING | cassava4.1_015543m | 1e-74 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA938 | 23 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 4e-72 | MIKC_MADS family protein |